Details for Arabidopsis Locus AT3G24750

Position : Chr3 ( 5`- 9036268 .. 9037757 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24750

Protein [Map View]
MAKIKAQGGEEQVTSTRFDLKKAIRVLQPEKQDDTNKEKSKSEQSKGKATLSRMKELIKWAAAAKSDKAVKFFTPKIMME
LKNRRKLKMMREVNEEESTKRMSSVSANISLRWESSESCTTNSSSDHISIVSSPGILVSLSPTPLYRCRSRKCNWITTDS
EFVVLELEL*

DNA
ATGGCAAAGATAAAAGCGCAAGGAGGAGAAGAACAAGTGACATCGACAAGGTTTGATCTGAAAAAGGCTATAAGAGTCTT
GCAACCGGAGAAACAAGACGATACCAATAAAGAGAAGTCGAAAAGCGAGCAGAGCAAAGGTAAGGCCACACTTTCAAGAA
TGAAGGAGCTTATCAAATGGGCTGCAGCAGCCAAATCCGACAAAGCTGTCAAATTCTTTACCCCTAAGATAATGATGGAG
TTGAAAAACCGAAGAAAGTTGAAGATGATGAGAGAAGTCAATGAAGAAGAATCAACAAAAAGGATGAGTAGTGTATCTGC
AAATATAAGTTTGAGATGGGAGAGTAGTGAGAGTTGCACAACAAACTCTTCCTCTGATCACATCTCTATAGTTTCTTCAC
CAGGAATCCTTGTTTCCTTGAGTCCTACGCCACTCTACCGATGTAGATCCAGGAAATGCAACTGGATCACTACTGATTCT
GAATTTGTGGTGTTAGAGTTAGAGTTATGA