Details for Arabidopsis Locus AT3G24740

Position : Chr3 ( 5`- 9031096 .. 9033796 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24740

Protein [Map View]
MAGVKRKLSTESDVHALHKELDEVSCPVCMDHPHNAVLLLCSSHDKGCRSYICDTSYRHSNCLDRFKKLHSESANDPTPE
ANLASREHNNESLYEHGTASRSSFHRESGNRGSSWDSESLRRRRRVEEEVESEDITNLKCPLCRGTVLGWKVVEEVRTYL
DHKNRSCSRESCSFTGNYQDLRRHARRTHPTTRPSDTDPSRERAWRRLENQREYGDIVSAIRSAMPGAVVVGDYVIENGD
RFAGERETGNGGSDLWTTLLLFQMIGSLDNGGSSASGSGGGSRSHRSRAWRNHRRSSSDRPYLWGENLLGLQDERNNNDD
EEFRLQNDAGGASTPVPRRRRRFGRPRSSGNHPR*

DNA
ATGGCTGGTGTAAAGCGAAAATTAAGTACCGAGTCAGATGTTCATGCTCTTCACAAAGAACTGGATGAGGTTTCATGTCC
TGTTTGCATGGATCACCCACATAATGCTGTTCTACTGCTGTGCAGCTCTCATGACAAAGGTTGCAGGTCCTACATCTGTG
ATACCAGTTACCGACATTCCAATTGCCTTGACCGGTTTAAGAAATTGCATTCTGAATCCGCAAATGACCCTACTCCCGAG
GCGAACTTGGCTTCAAGGGAACATAATAACGAATCTCTATACGAGCATGGTACAGCCAGTCGAAGCAGTTTTCACCGTGA
GTCTGGAAACCGAGGCTCTTCTTGGGATTCCGAATCACTGAGGAGGAGGAGGAGAGTTGAGGAAGAAGTTGAGTCAGAAG
ATATCACAAATTTGAAATGTCCTCTATGCCGGGGTACTGTTTTAGGATGGAAGGTTGTAGAAGAAGTAAGAACGTATCTT
GATCATAAGAACCGAAGTTGCTCCCGAGAATCCTGCTCATTTACTGGCAACTACCAGGATCTGCGCCGCCATGCCAGGAG
GACTCACCCAACAACTCGTCCTTCAGACACTGATCCATCAAGAGAGAGAGCTTGGAGGCGGCTTGAGAACCAGAGGGAGT
ATGGAGATATAGTCAGTGCAATCCGTTCTGCCATGCCCGGTGCTGTTGTAGTAGGAGATTATGTTATAGAAAACGGAGAT
AGGTTTGCAGGTGAGAGGGAAACGGGAAATGGTGGGAGCGACCTTTGGACCACTTTACTATTGTTTCAGATGATTGGCTC
TCTTGACAATGGAGGTTCTAGCGCTAGTGGGAGTGGTGGTGGATCAAGATCCCACAGGTCAAGGGCATGGAGGAATCATC
GGCGTTCATCTTCAGATAGGCCGTACCTTTGGGGGGAGAATCTATTGGGTCTACAAGATGAGCGCAATAACAACGATGAT
GAAGAGTTTCGTTTGCAGAATGATGCAGGCGGTGCTTCTACTCCTGTTCCAAGAAGAAGAAGGAGATTTGGACGTCCTAG
ATCAAGCGGAAATCATCCGCGATAA