Details for Arabidopsis Locus AT3G24690

Position : Chr3 ( 5`- 9020651 .. 9021491 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24690

Protein [Map View]
MAAVEGQISALISKRLRTLRKKYNRITDMEESISQGKTLNKEQEDTLRSKPIVSALIDELVKLRIPPPSAAISEETSPPA
KNKKQQKLSHARKEVAEEENVTAKTDIEDCKISDDGINSEVSKDDTSPSSESSQGVTPSPLSRKARRKRNAKKPQIPQ*

DNA
ATGGCCGCCGTAGAAGGACAAATCTCGGCTCTCATCAGCAAACGTCTCCGTACTCTCCGCAAGAAATACAACCGTATAAC
TGACATGGAAGAGTCGATTTCTCAGGGGAAAACACTAAACAAGGAACAAGAAGACACCCTCCGTTCAAAGCCAATCGTCT
CCGCCCTTATCGATGAGCTCGTAAAGCTCCGCATTCCTCCTCCTTCTGCAGCCATTTCAGAAGAGACCAGCCCCCCTGCT
AAGAACAAGAAACAGCAAAAGTTATCCCACGCACGTAAGGAGGTAGCTGAGGAGGAAAACGTGACGGCCAAGACAGATAT
CGAGGATTGCAAGATCTCTGATGATGGTATCAATTCTGAGGTTTCCAAGGACGATACTTCTCCTAGTAGCGAAAGCTCAC
AAGGTGTTACGCCATCGCCGCTTAGCAGAAAGGCACGACGTAAACGGAACGCGAAGAAACCTCAAATTCCACAGTGA