Details for Arabidopsis Locus AT3G24660

Position : Chr3 ( 5`- 9003576 .. 9005943 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24660

Protein [Map View]
MGMEALRFLHVIFFFVLILHCHCGTSLSGSSDVKLLLGKIKSSLQGNSESLLLSSWNSSVPVCQWRGVKWVFSNGSPLQC
SDLSSPQWTNTSLFNDSSLHLLSLQLPSANLTGSLPREIGEFSMLQSVFLNINSLSGSIPLELGYTSSLSDVDLSGNALA
GVLPPSIWNLCDKLVSFKIHGNNLSGVLPEPALPNSTCGNLQVLDLGGNKFSGEFPEFITRFKGVKSLDLSSNVFEGLVP
EGLGVLELESLNLSHNNFSGMLPDFGESKFGAESFEGNSPSLCGLPLKPCLGSSRLSPGAVAGLVIGLMSGAVVVASLLI
GYLQNKKRKSSIESEDDLEEGDEEDEIGEKEGGEGKLVVFQGGENLTLDDVLNATGQVMEKTSYGTVYKAKLSDGGNIAL
RLLREGTCKDRSSCLPVIRQLGRIRHENLVPLRAFYQGKRGEKLLIYDYLPNISLHDLLHESKPRKPALNWARRHKIALG
IARGLAYLHTGQEVPIIHGNIRSKNVLVDDFFFARLTEFGLDKIMVQAVADEIVSQAKSDGYKAPELHKMKKCNPRSDVY
AFGILLLEILMGKKPGKSGRNGNEFVDLPSLVKAAVLEETTMEVFDLEAMKGIRSPMEEGLVHALKLAMGCCAPVTTVRP
SMEEVVKQLEENRPRNRSALYSPTETRSDAETPF*

DNA
ATGGGCATGGAAGCTTTGAGATTTCTTCATGTTATCTTCTTCTTTGTGCTAATTCTTCACTGTCATTGTGGAACATCTCT
CTCTGGTTCTTCTGATGTGAAGCTTCTTTTAGGAAAAATCAAGTCTTCACTACAAGGAAACAGTGAGAGCTTACTGTTGT
CTTCTTGGAACTCCTCTGTTCCTGTTTGTCAATGGAGAGGTGTAAAATGGGTATTTTCAAATGGGTCTCCTCTTCAATGT
AGTGACCTCTCTTCACCACAATGGACTAATACCTCTCTGTTCAACGACTCTTCTCTTCACCTTCTCTCTCTTCAGCTTCC
TTCTGCTAATCTCACTGGTTCACTCCCTAGAGAGATTGGTGAGTTCTCTATGCTTCAAAGTGTGTTCCTCAACATCAATT
CATTAAGTGGGTCAATCCCTCTTGAGCTTGGTTACACTTCTTCTCTCTCTGATGTTGATTTGAGTGGTAATGCCTTAGCT
GGGGTTTTGCCTCCATCGATTTGGAACCTCTGTGATAAGCTTGTCTCTTTCAAGATTCATGGTAATAACTTGTCTGGGGT
TTTGCCTGAGCCTGCTTTGCCAAATTCGACTTGTGGTAATCTCCAAGTTCTTGATTTGGGTGGTAATAAGTTCTCAGGTG
AGTTTCCTGAGTTTATAACTAGGTTTAAAGGTGTGAAGTCACTTGATCTTTCAAGTAATGTCTTTGAAGGTCTTGTTCCT
GAGGGTTTAGGTGTATTAGAGCTAGAAAGTCTCAATCTTTCTCATAATAACTTCAGTGGGATGTTGCCAGATTTTGGTGA
GTCAAAGTTTGGAGCAGAATCTTTCGAAGGGAACAGTCCTAGCCTTTGTGGTTTGCCTTTGAAGCCTTGTCTAGGCTCCT
CTAGGTTAAGTCCAGGTGCTGTTGCTGGTCTGGTGATTGGTTTAATGTCTGGAGCTGTTGTTGTGGCCTCGTTGTTAATA
GGGTATTTGCAGAACAAGAAAAGAAAGAGTAGTATAGAGAGTGAAGATGATTTGGAAGAAGGTGATGAAGAAGATGAAAT
CGGTGAGAAAGAAGGCGGTGAAGGAAAGTTAGTTGTGTTTCAAGGTGGTGAGAATCTGACGTTGGATGATGTTTTGAATG
CTACTGGGCAAGTTATGGAGAAGACTAGCTATGGTACTGTCTATAAAGCTAAGCTTAGTGATGGAGGGAATATTGCATTG
AGGCTATTGAGAGAAGGTACTTGCAAGGATAGAAGTTCTTGTCTGCCTGTTATAAGGCAGTTAGGACGCATTCGGCATGA
GAATTTGGTTCCCTTGAGAGCTTTCTATCAAGGGAAGAGAGGAGAAAAGCTTCTCATCTATGACTATCTTCCCAACATAA
GCTTACATGATTTGTTGCATGAAAGTAAACCTCGAAAGCCAGCTTTGAATTGGGCTAGGAGACACAAGATTGCACTTGGA
ATAGCGAGGGGACTTGCTTATCTTCATACTGGACAAGAAGTTCCTATCATCCATGGAAATATTAGATCAAAGAACGTGCT
TGTGGACGACTTTTTCTTTGCAAGGCTAACTGAGTTTGGGCTTGACAAGATAATGGTACAGGCAGTAGCAGATGAGATTG
TCTCGCAGGCGAAATCCGACGGGTACAAAGCACCTGAACTCCACAAGATGAAGAAATGCAATCCAAGGAGTGATGTTTAC
GCCTTTGGGATCCTTCTCTTGGAGATATTGATGGGTAAGAAACCAGGAAAGAGTGGAAGGAACGGTAATGAGTTTGTGGA
CTTGCCTTCTTTGGTTAAAGCTGCGGTGTTGGAAGAGACGACAATGGAGGTTTTCGACTTGGAGGCAATGAAAGGGATTA
GGAGCCCAATGGAAGAAGGTTTGGTTCATGCATTGAAGCTAGCGATGGGATGTTGTGCTCCTGTTACAACAGTTAGACCC
AGCATGGAAGAGGTTGTGAAGCAGTTGGAAGAGAACAGACCGAGGAATAGATCCGCATTGTACAGCCCAACCGAAACCAG
GAGCGACGCCGAAACTCCATTTTGA