Details for Arabidopsis Locus AT3G24650

Position : Chr3 ( 5`- 8997370 .. 9001063 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24650

Protein [Map View]
MKSLHVAANAGDLAEDCGILGGDADDTVLMDGIDEVGREIWLDDHGGDNNHVHGHQDDDLIVHHDPSIFYGDLPTLPDFP
CMSSSSSSSTSPAPVNAIVSSASSSSAASSSTSSAASWAILRSDGEDPTPNQNQYASGNCDDSSGALQSTASMEIPLDSS
QGFGCGEGGGDCIDMMETFGYMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQEDQVVVPMMENNSGGDMQMMNSSL
EQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILEWVQTNHLQRRRTTTTTTNLSY
QQSFQQDPFQNPNPNNNNLIPPSDQTCFSPSTWVPPPPQQQAFVSDPGFGYMPAPNYPPQPEFLPLLESPPSWPPPPQSG
PMPHQQFPMPPTSQYNQFGDPTGFNGYNMNPYQYPYVPAGQMRDQRLLRLCSSATKEARKKRMARQRRFLSHHHRHNNNN
NNNNNNQQNQTQIGETCAAVAPQLNPVATTATGGTWMYWPNVPAVPPQLPPVMETQLPTMDRAGSASAMPRQQVVPDRRQ
GWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENT
GDFVKTNGLQEGDFIVIYSDVKCGKYLIRGVKVRQPSGQKPEAPPSSAATKRQNKSQRNINNNSPSANVVVASPTSQTVK
*

DNA
ATGAAAAGCTTGCATGTGGCGGCCAACGCCGGAGATCTGGCTGAGGATTGTGGAATACTCGGTGGAGACGCTGATGATAC
TGTTTTGATGGATGGAATTGATGAAGTTGGTAGAGAGATCTGGTTAGATGACCATGGAGGAGATAATAATCATGTTCATG
GTCATCAAGATGATGATTTGATTGTTCATCATGACCCTTCAATCTTCTATGGAGATCTCCCAACGCTTCCTGATTTCCCA
TGCATGTCGTCTTCATCATCGTCTTCAACATCTCCAGCTCCTGTCAACGCAATCGTCTCCTCAGCCTCTTCTTCTTCGGC
AGCTTCTTCCTCCACTTCCTCAGCTGCTTCTTGGGCTATATTGAGATCAGATGGAGAAGATCCGACTCCAAACCAAAACC
AATACGCATCAGGAAACTGTGACGACTCTTCTGGTGCATTGCAATCCACAGCTTCCATGGAGATTCCATTAGACAGCAGT
CAAGGTTTTGGTTGCGGCGAAGGCGGTGGTGATTGCATTGATATGATGGAGACTTTCGGGTACATGGATCTACTTGATAG
CAACGAGTTCTTTGACACCTCAGCTATATTTAGCCAAGACGACGACACGCAAAACCCTAACTTGATGGACCAAACCCTTG
AGAGACAAGAAGACCAGGTCGTTGTTCCGATGATGGAGAATAACAGTGGTGGAGACATGCAAATGATGAATTCTTCCTTG
GAACAGGACGATGATCTCGCTGCTGTGTTTTTGGAGTGGCTAAAGAACAACAAGGAGACTGTGTCGGCTGAGGATTTGAG
GAAAGTAAAGATAAAGAAAGCTACGATTGAATCAGCGGCAAGAAGACTAGGCGGTGGTAAAGAAGCGATGAAGCAGCTTT
TAAAGCTGATTCTTGAATGGGTCCAAACTAATCACTTACAAAGAAGACGCACCACCACCACCACCACCAACCTCTCTTAT
CAACAATCATTCCAACAAGATCCATTTCAAAACCCTAACCCTAATAACAACAACCTAATCCCACCGTCCGACCAAACCTG
TTTCTCACCTTCAACATGGGTTCCTCCACCACCACAACAACAAGCTTTTGTCTCGGACCCGGGTTTTGGATACATGCCTG
CTCCAAACTATCCGCCACAGCCAGAGTTCCTTCCTTTACTTGAATCTCCACCGTCATGGCCACCACCACCACAGTCTGGT
CCCATGCCACATCAACAATTCCCCATGCCGCCAACCTCGCAGTATAATCAATTTGGAGATCCAACAGGTTTCAATGGATA
CAACATGAATCCGTACCAATATCCTTATGTTCCTGCAGGACAAATGAGAGATCAGAGATTACTCCGTTTGTGTTCCTCAG
CAACTAAAGAGGCAAGAAAGAAACGGATGGCGAGACAGAGGAGGTTCTTGTCTCATCACCACAGACATAACAACAACAAC
AACAACAACAACAATAATCAGCAGAACCAAACCCAAATCGGAGAAACCTGTGCCGCGGTGGCTCCACAACTTAACCCCGT
GGCCACAACCGCCACGGGAGGGACCTGGATGTATTGGCCTAATGTCCCGGCAGTGCCGCCTCAATTACCGCCAGTGATGG
AGACTCAGTTACCTACCATGGACCGAGCTGGCTCAGCTTCTGCTATGCCACGTCAGCAGGTGGTACCAGATCGCCGGCAG
GGATGGAAACCAGAAAAGAATTTGCGGTTTCTCTTGCAGAAAGTCTTGAAGCAAAGCGACGTGGGTAACCTCGGAAGGAT
CGTTTTGCCAAAAAAAGAAGCTGAGACACACTTGCCGGAGCTAGAGGCAAGAGACGGCATCTCTCTGGCCATGGAAGACA
TCGGAACCTCTCGTGTTTGGAACATGCGCTACAGGTTTTGGCCTAACAACAAAAGCAGGATGTATCTCCTCGAGAACACC
GGCGATTTTGTGAAAACCAATGGGCTCCAAGAAGGTGATTTCATAGTCATATACTCCGACGTCAAATGTGGCAAATATTT
GATACGAGGGGTTAAAGTAAGACAACCGAGCGGACAAAAGCCGGAGGCCCCACCGTCGTCAGCAGCTACGAAGAGACAAA
ACAAGTCGCAAAGGAACATAAACAATAACTCTCCGTCGGCGAATGTGGTGGTCGCTTCACCAACTTCTCAAACTGTTAAA
TGA