Details for Arabidopsis Locus AT3G24630

Position : Chr3 ( 5`- 8988055 .. 8990873 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24630

Protein [Map View]
MPEGKLRSGVYRSFIMCDDPRDVVECGAIKKQSKSRSSSTKQRCEEHLSKVKERSEMAVAPRKSSSTEDVPPSSLQLLRV
SKGIQKLNVAIESLSKGFSFEAVSRPEDIAKDLLRGALDLEESLAMLSSIQEDDSKRKPMIRNDGRSDLRFQRSMSDRFG
ERIEKRMMVQENVASKDCYEELRKVIRESFLRQNLVSQTTTIETKKRVVRSDFASSSGAVSSSTSSSQSSMVSGSTKSSA
SSDVPQRAPSLIARLMGLDVSTQEPRKSSVNHIDKPDILKLSSERQEKVKKNSKESPEIVRCNSTREAALQSLPEETPSE
NPSTIVLIRPMRVVKPEPGSKQPVVPKKPRMQGEVHPRMINQRKDHQANGSNKMKLPLRMTKKDKEPKEMVPKVEENEGK
VIKLMSPSNAKVLTRDRKPLETNKKLVVKKDDIAEGKDRHRALKPPSNPVSQKISNNSSDVSRNKSRRSSRLSSSSSSGS
REKKSGEASRPNAKKKLRQQDNDLGSENNSCSSQETHGSLNQLSTEETTSSEFHNQGHCDNGEVSSCAATIHHSHEPETS
QISLKSFLSTSSDFISYAEDLFDFNTNTERSRESNFRRRDSIVISDQRLALDFAKEVVRRKSLLLAEPTCHTRSSLDIDE
LLTEVCDGFESLTSYKDTFSGQNSFVKESIHLVLEKDLKGKKTEMTSGVWDLGWRSEFQIDETYEAVADLEKLILSGLIQ
EIIS*

DNA
ATGCCTGAAGGGAAATTAAGATCAGGAGTTTATAGATCATTCATAATGTGTGATGATCCAAGAGATGTTGTTGAATGTGG
AGCTATTAAGAAACAGAGTAAGAGCCGTAGTAGTAGTACTAAACAGAGATGTGAAGAACATCTTTCGAAAGTGAAAGAGC
GGTCCGAAATGGCGGTGGCGCCTAGGAAGAGTAGTAGTACAGAGGATGTTCCTCCTTCTTCGTTGCAGCTTTTGAGAGTA
TCCAAAGGGATTCAGAAATTGAATGTTGCAATTGAGTCATTGTCTAAAGGTTTTAGCTTTGAGGCGGTGTCAAGGCCTGA
GGATATAGCGAAAGATCTGTTGAGAGGAGCTCTTGATTTGGAAGAGTCTTTAGCTATGTTAAGTAGTATTCAAGAAGATG
ATAGTAAGCGGAAACCGATGATTCGGAACGATGGAAGAAGCGATTTGCGGTTTCAAAGATCGATGTCTGATAGATTCGGA
GAGCGGATTGAGAAACGGATGATGGTTCAAGAGAATGTAGCGTCTAAGGATTGTTATGAAGAGTTAAGGAAAGTGATTAG
AGAGAGTTTTCTTAGGCAGAATCTTGTTTCACAAACAACTACTATAGAGACTAAGAAACGAGTTGTTAGAAGTGATTTTG
CTTCCTCTTCTGGAGCTGTGTCGTCGTCAACTAGCTCGAGCCAATCTTCAATGGTTTCTGGCTCTACTAAGTCCTCTGCT
TCGTCTGATGTTCCACAGAGAGCTCCAAGTTTGATTGCTAGGCTTATGGGTTTGGATGTATCAACTCAAGAACCGAGGAA
AAGCTCGGTGAATCATATCGATAAGCCGGATATTTTAAAGCTGTCATCAGAAAGACAAGAGAAGGTGAAGAAGAATAGTA
AGGAGAGTCCTGAAATTGTGAGATGCAACTCTACAAGAGAAGCTGCTTTACAGTCTTTGCCTGAAGAGACTCCGAGCGAG
AATCCTTCGACTATAGTACTCATCAGACCTATGCGTGTTGTAAAACCGGAACCGGGAAGCAAACAACCGGTTGTACCAAA
GAAACCGAGAATGCAAGGGGAGGTTCATCCAAGAATGATTAACCAGAGAAAAGATCATCAAGCTAATGGAAGCAACAAAA
TGAAATTACCATTACGTATGACCAAGAAGGACAAAGAACCGAAAGAAATGGTGCCTAAAGTAGAAGAGAATGAAGGTAAG
GTCATCAAGCTAATGTCTCCAAGCAATGCCAAAGTTCTAACAAGAGATCGAAAACCGTTGGAAACCAACAAAAAACTTGT
TGTCAAGAAGGATGATATTGCTGAAGGCAAAGACAGACATAGAGCTCTTAAACCACCCAGCAATCCTGTGAGTCAAAAGA
TATCGAACAATTCTTCAGACGTATCAAGAAACAAGAGTCGACGTTCCAGTAGGTTGAGCTCAAGCTCTAGTAGTGGTAGC
CGGGAAAAGAAGTCCGGTGAGGCTAGTAGACCAAATGCCAAGAAGAAACTCCGTCAACAAGACAACGACCTCGGTTCAGA
GAATAATTCATGCTCTTCACAAGAGACGCATGGATCACTTAACCAACTGTCTACAGAGGAAACCACTTCTTCAGAGTTTC
ACAATCAAGGCCATTGTGACAATGGAGAAGTTTCATCATGTGCTGCCACAATTCACCATTCTCATGAGCCAGAAACATCC
CAAATCTCTCTTAAGTCATTCCTATCCACCTCCTCGGATTTCATCAGCTACGCAGAGGATCTCTTCGACTTCAACACCAA
CACCGAACGAAGCAGAGAATCAAACTTTCGAAGAAGAGATAGCATTGTGATCTCAGACCAAAGACTAGCACTAGACTTTG
CCAAAGAAGTAGTCAGACGCAAAAGCCTTCTTCTAGCAGAACCAACGTGTCACACACGAAGCTCTTTGGACATTGATGAG
TTGTTGACAGAAGTCTGTGATGGGTTTGAGTCTCTGACAAGTTACAAAGACACGTTTTCAGGACAAAACAGCTTCGTTAA
AGAGAGCATTCACTTGGTGTTGGAGAAGGATTTAAAGGGTAAGAAGACAGAGATGACAAGTGGAGTTTGGGATTTGGGTT
GGAGAAGTGAGTTTCAGATTGATGAAACTTATGAAGCTGTAGCTGACTTAGAGAAACTTATCTTGTCCGGTTTGATCCAA
GAGATTATCTCTTGA