Details for Arabidopsis Locus AT3G24570

Position : Chr3 ( 5`- 8966521 .. 8968657 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24570

Protein [Map View]
MLKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKRRLLRLTETNKDADADAEIKVKWKQDAEFKVNWKRV
AITSMFGFGFVGPVGHFWYEGLDKFIKLKLRYVPKSTRFVAAKVAMDGLIFGPVDLLVFFTYMGFATGKNTAEVKEGLKR
DFLPALALEGGAWPLLQIANFRYVPVQYQLLYVNIFCLVDSAFLSWVEQQKDAAWKQWFTSSFQPLKERGGQGGV*

DNA
ATGTTGAAGCTTTGGAGATGGTACCAGCGATGCCTGACGGTTCATCCTGTGAAAACTCAGGTCATCAGTTCTGGATTTCT
TTGGGGATTTGGCGATGTCACCGCTCAATACATCACTCATTCCACTGCGAAACGTCGTCTTCTTCGTCTCACCGAAACAA
ATAAAGATGCTGACGCAGATGCAGAAATTAAGGTCAAGTGGAAGCAAGATGCAGAATTCAAAGTCAACTGGAAGCGAGTA
GCTATCACGAGCATGTTTGGATTTGGTTTTGTCGGACCTGTTGGCCACTTCTGGTACGAAGGCTTGGATAAATTCATAAA
ACTGAAGCTTCGATATGTACCAAAGTCAACACGTTTTGTAGCTGCAAAAGTTGCAATGGATGGTCTTATCTTTGGACCTG
TAGATCTACTGGTGTTCTTCACATACATGGGATTCGCCACAGGAAAGAACACAGCTGAAGTGAAAGAAGGACTCAAGAGA
GATTTTCTTCCGGCTCTAGCTCTTGAAGGCGGAGCATGGCCACTTCTTCAGATTGCAAACTTCAGATATGTTCCCGTGCA
ATACCAGTTGCTTTACGTCAACATCTTTTGCCTAGTAGACAGTGCCTTCCTCTCATGGGTCGAGCAACAGAAGGACGCAG
CTTGGAAGCAATGGTTTACTTCATCATTTCAACCATTAAAAGAACGAGGTGGCCAAGGCGGAGTATGA