Details for Arabidopsis Locus AT3G24560

Position : Chr3 ( 5`- 8963770 .. 8966616 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24560

Protein [Map View]
MARGLSLCSNGRKSSTLLSNSIPRVSISFSPKTLFTCSYPLQSRHPKFSQRLFCNHACVPETVDETRYKELFNKRMDMAG
LKPHNRIALGVSGGPDSMALCVLTAKWKTEGLSCVNKTDGFIDGLVAIVVDHGLRQESKDEAELVCSRVSQMGIRCEIAS
CDWVDGRPKLGHLQEAAREMRYEMISNVCFRQQIEVLLIAHHADDQAELFILRLSRSSGVLGLAGTAFASEIFSRNLQLD
AKHMKNQSIRLVRPLLDLWKEDMYKICQWGRQDWVEDPTNRSQLFVRNRIRTSIGNLESGSFKSELQAVISECRRTRSFV
DKVCTDLIHQTVTVTDKGYAILDLERLNPSGVKDICLSKYLFAVLQFISQRQRPIRGNTSKLLLNYIRAIPCRTSLTAAG
CYLSPAPGSKGTKIIVSCSVDCPLPSKTELLNISFNETPSDDLGQIIADAKSFSDHVAPTSLFEVQFLDVASESVLSKAR
ELNLLSESTYTTIGLLQRDETKRFLTKTEEKSVELEHGTNIAASSDKVHLCLGQNLYFMNRFLIRWNLSDHQCNEADCRN
CPVSTATSMEVRHMVEPDWLYLAELSKCSTSNHSISSSQKALRSLKLIPAAARKSLPVLVNHCGLLLCIPAIGFSYCSCL
EASAVFLPRIPLGGGHSSFL*

DNA
ATGGCGCGAGGTCTGTCTCTATGCTCCAATGGAAGAAAGTCTTCGACTTTACTCTCAAACTCCATCCCTAGGGTTTCAAT
TTCCTTTTCTCCTAAAACCCTTTTCACTTGTTCATATCCACTTCAATCCCGCCACCCAAAATTCTCACAACGATTGTTCT
GTAATCACGCCTGTGTCCCGGAGACTGTGGACGAAACGAGGTACAAGGAGCTTTTCAATAAGAGAATGGATATGGCAGGA
CTTAAACCTCACAACCGAATTGCTTTGGGAGTTTCAGGTGGTCCTGATAGTATGGCTCTTTGTGTTCTAACTGCAAAATG
GAAAACTGAAGGATTAAGTTGTGTTAATAAGACAGATGGTTTTATTGATGGACTTGTTGCTATAGTTGTTGATCATGGAT
TAAGACAAGAGAGTAAAGATGAAGCTGAACTTGTCTGTTCTAGAGTTTCTCAAATGGGAATCAGATGTGAGATTGCAAGT
TGTGATTGGGTTGATGGTAGACCAAAGCTTGGCCACTTGCAAGAAGCAGCTCGTGAAATGAGGTATGAGATGATTTCGAA
TGTGTGTTTTCGACAACAGATTGAGGTCTTGCTTATAGCGCATCATGCAGATGACCAGGCTGAGTTATTCATTCTCAGGT
TATCTCGTAGTAGCGGTGTACTTGGTCTTGCGGGTACAGCTTTTGCTTCCGAGATTTTCTCCAGAAATCTGCAGTTAGAT
GCAAAACATATGAAGAACCAATCTATTCGCTTAGTGCGTCCGCTACTAGATTTATGGAAAGAAGACATGTACAAGATATG
TCAATGGGGTAGACAAGATTGGGTTGAAGATCCAACTAATCGTAGTCAGTTGTTTGTTCGGAATAGGATTCGAACATCAA
TAGGAAATCTAGAATCAGGTAGCTTCAAGTCAGAGCTGCAAGCAGTCATTTCTGAATGCAGGAGAACACGTTCATTTGTT
GATAAAGTTTGTACAGACTTAATACATCAGACCGTAACAGTGACAGATAAAGGGTATGCTATTCTTGATCTAGAGAGACT
TAATCCTTCAGGAGTTAAAGACATTTGCCTCTCAAAGTATCTCTTTGCGGTCCTGCAGTTTATCTCTCAACGGCAAAGAC
CAATCAGAGGAAACACTTCAAAGTTGCTTTTGAACTATATCCGCGCAATTCCGTGCAGGACATCTCTAACAGCTGCTGGT
TGCTACCTTAGTCCTGCTCCAGGGTCGAAGGGTACCAAAATTATAGTCTCATGTTCTGTTGACTGTCCTTTACCATCAAA
GACAGAACTCTTGAACATTTCCTTCAATGAAACTCCATCTGATGACCTTGGACAAATCATAGCAGACGCAAAATCGTTTT
CTGACCATGTGGCTCCAACCAGCTTGTTTGAAGTCCAGTTTCTGGATGTTGCATCTGAATCCGTATTGAGTAAAGCCAGA
GAGCTCAATCTTCTCAGCGAATCGACGTATACAACCATTGGTCTACTGCAGAGGGATGAAACTAAACGGTTTTTAACTAA
AACAGAAGAGAAATCAGTGGAATTAGAGCATGGAACCAACATTGCAGCTTCCTCTGATAAAGTACATCTTTGTCTAGGGC
AAAATCTCTACTTCATGAACCGTTTTCTCATCAGATGGAACCTAAGTGACCACCAATGTAATGAAGCAGACTGCAGAAAT
TGTCCAGTGAGTACTGCTACATCAATGGAGGTTCGGCACATGGTTGAACCCGACTGGTTATATCTAGCTGAGCTTTCAAA
ATGCTCAACCTCAAATCATTCTATTTCATCCTCACAAAAAGCTCTCAGGTCCTTAAAGTTGATCCCAGCCGCTGCAAGAA
AAAGCCTTCCTGTCTTGGTCAATCACTGTGGATTACTACTCTGCATACCAGCTATTGGCTTCAGTTATTGTTCATGCCTT
GAGGCATCTGCAGTGTTTCTTCCAAGAATACCACTCGGAGGCGGTCATAGCTCATTTCTCTAG