Details for Arabidopsis Locus AT3G24530

Position : Chr3 ( 5`- 8945425 .. 8947938 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24530

Protein [Map View]
MNRQNGGGQRLRSARPTTIHDCALSGDLIALQRLLKDNPSLLNERNPVMYHTPLHVSAGNGNVDIVKYLLAWTGSDKVEL
EAMNTYGETPLHMAAKNGCNEAAKLLLESGAFIEAKASNGMTPLHLAVWYSITAKEISTVKTLLDHNADCSAKDNEGMTP
LDHLPQGQGSEKLRELLRWFLQEQRKRSALEQCGKTKAKMELLEDELSNIVGLSELKTQLRKWAKGMLLDERRRALGLNI
GTRRPPHMAFLGNPGTGKTMVARVLGKLLNTVGILPTDKVTEVQRTDLVGEFVGHTGPKTRRKIQEAEGGILFVDEAYRL
IPMQKADDKDYGLEALEEIMSVMDTGKIVVIFAGYSEPMKRVIASNEGFCRRVTKFFNFSDFSAKELAQILHIKMNNQGE
DTLFYGFRLHESCTLQEIASLIEAETTEKQRKEMNGGLVDTLLVNARENLDLRLSFECVDTEEICTIKLEDLEAGLRVFS
Q*

DNA
ATGAACCGACAAAACGGTGGAGGGCAGCGGCTGAGATCCGCTAGACCCACCACAATTCACGATTGTGCTCTCTCCGGCGA
TCTTATTGCTTTACAGAGACTTCTTAAAGACAATCCTTCTCTTCTCAATGAACGCAATCCCGTCATGTATCATACGCCAC
TTCATGTTTCTGCTGGTAATGGTAATGTTGATATTGTTAAGTATCTTCTCGCTTGGACTGGATCTGATAAAGTTGAGTTA
GAAGCAATGAATACTTATGGTGAGACTCCATTGCATATGGCAGCTAAGAACGGTTGTAATGAAGCTGCAAAGCTACTCCT
TGAGAGTGGTGCTTTTATCGAAGCTAAAGCCAGCAATGGTATGACACCGTTGCATCTTGCGGTATGGTACTCAATTACTG
CTAAAGAGATCTCGACTGTTAAGACACTGCTTGATCATAACGCAGATTGCAGTGCAAAAGATAATGAAGGGATGACTCCT
TTGGACCATCTGCCTCAAGGGCAAGGCAGTGAGAAGTTACGGGAATTACTGCGGTGGTTTCTCCAAGAGCAGAGGAAAAG
AAGTGCGCTTGAGCAATGTGGTAAGACAAAAGCCAAGATGGAACTACTTGAGGATGAGTTATCAAATATTGTTGGATTAA
GTGAGCTGAAGACACAACTGAGGAAATGGGCGAAAGGAATGCTTTTAGATGAAAGGCGAAGGGCTCTTGGGCTAAATATT
GGAACCCGAAGACCTCCGCATATGGCATTTCTTGGAAACCCTGGAACAGGTAAAACCATGGTAGCTCGAGTTCTCGGGAA
GCTGCTTAACACGGTTGGAATTTTACCAACTGATAAGGTAACAGAAGTACAGCGTACAGATTTGGTGGGTGAGTTTGTTG
GCCATACAGGACCAAAGACCAGGAGAAAGATCCAAGAAGCTGAGGGAGGAATTCTGTTTGTGGATGAAGCATACAGATTG
ATCCCGATGCAAAAGGCGGACGACAAGGACTACGGTCTAGAAGCTCTGGAAGAAATCATGTCAGTCATGGACACAGGGAA
AATTGTGGTGATATTTGCAGGATACAGCGAGCCCATGAAGCGTGTGATCGCATCAAACGAAGGGTTTTGCAGAAGGGTCA
CAAAGTTTTTCAATTTCAGCGACTTCAGTGCCAAGGAACTGGCGCAGATACTACACATCAAGATGAACAACCAAGGAGAG
GACACTCTGTTCTATGGTTTCAGATTGCATGAGTCCTGCACTTTGCAGGAGATAGCGTCACTGATAGAGGCAGAAACAAC
GGAAAAGCAGAGGAAAGAGATGAATGGAGGATTGGTGGACACGTTACTTGTTAACGCGAGGGAGAATCTTGATCTCCGAC
TTAGCTTTGAGTGTGTTGACACTGAAGAGATTTGTACAATCAAGTTGGAGGATCTAGAGGCCGGGCTTCGAGTTTTCTCG
CAGTGA