Details for Arabidopsis Locus AT3G24520

Position : Chr3 ( 5`- 8941066 .. 8942874 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24520

Protein [Map View]
MEDDNSNNNNNNNVIAPFIVKTYQMVNDPSTDWLITWGPAHNSFIVVDPLDFSQRILPAYFKHNNFSSFVRQLNTYGFRK
VDPDRWEFANEHFLRGQKHLLNNIARRKHARGMYGQDLEDGEIVREIERLKEEQRELEAEIQRMNRRIEATEKRPEQMMA
FLYKVVEDPDLLPRMMLEKERTKQQQQVSDKKKRRVTMSTVKSEEEEVEEDEGRVFRVMSSSTPSPSSTENLYRNHSPDG
WIVPMTQGQFGSYETGLVAKSMLSNSTSSTSSSLTSTFSLPESVNGGGGGGCGSIQGERRYKETATFGGVVESNPPTTPP
YPFSLFRGGF*

DNA
ATGGAGGACGACAATAGTAACAACAACAACAACAACAACGTGATCGCACCTTTCATCGTGAAAACATATCAGATGGTCAA
TGATCCTTCCACCGATTGGCTCATCACTTGGGGACCTGCTCACAACAGTTTCATAGTCGTTGATCCACTCGACTTCTCGC
AACGAATCTTACCTGCTTATTTCAAACACAACAATTTCAGCAGTTTTGTTCGTCAACTCAACACCTATGGGTTTAGGAAA
GTGGATCCGGACCGGTGGGAGTTTGCGAACGAGCATTTTCTAAGGGGACAGAAGCATTTGTTGAATAACATAGCGCGTAG
GAAACACGCGCGGGGGATGTACGGTCAAGATTTGGAGGACGGTGAGATTGTGAGGGAGATCGAACGGTTAAAAGAAGAGC
AGAGGGAGCTAGAGGCAGAGATTCAGAGGATGAACCGGAGGATCGAAGCGACGGAGAAGAGACCGGAGCAGATGATGGCG
TTTCTTTACAAAGTCGTTGAAGATCCTGATCTTCTTCCAAGAATGATGCTCGAGAAAGAACGGACAAAGCAACAACAACA
AGTTTCCGACAAGAAGAAGCGTCGTGTCACGATGTCGACGGTGAAGTCAGAGGAAGAAGAAGTGGAAGAAGATGAAGGGA
GGGTCTTTAGGGTTATGTCATCATCAACACCGTCGCCGTCATCAACGGAGAATCTTTACCGGAATCATTCACCGGATGGG
TGGATTGTTCCTATGACGCAAGGACAGTTTGGTAGTTACGAGACGGGTTTGGTGGCGAAGTCGATGCTCTCGAATTCAAC
GTCGTCGACGTCATCATCTTTGACGTCGACGTTTTCTTTGCCGGAGAGTGTTAACGGAGGAGGAGGAGGAGGATGTGGGA
GTATTCAGGGAGAAAGAAGGTATAAAGAAACGGCGACGTTTGGAGGAGTGGTAGAGTCAAATCCACCAACAACACCGCCT
TATCCATTTTCTCTGTTTCGAGGTGGCTTTTAG