Details for Arabidopsis Locus AT3G24515

Position : Chr3 ( 5`- 8934472 .. 8936279 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24515

Protein [Map View]
MAQAARLSLRMQKELKLLLSDPPHGASFPHLSSAANGSGDFSTFSTIDAQIEGPEDTVYANGIFNLKIQIPERYPFQPPI
VSFATPIYHPNIDNSGRICLDILNLPPKGAWQPSLNISTVLTSMRLLLSEPNPDDGLMCEVSREYKYNRQTFDYKAREMT
EKYAKVKADGCSTSLQIKNHGDEKSGESGNSVKLKLTVESSLSIAHTVKRETAGRDEQEDGNGKRKAVVGFGEGNSFGND
GIKRSRKKLSLALPSQSQKKDLCGEEELTRGVSAACKENKKPNLNGKKLSLGLKQPCNDTLASFRTSAAKSDNNRLSRKL
SLRSPLGELNEVSKPEVLAQTDMKLEMNQNEDARSLRGEFENSVLEETSMAESIVVLDSDDSGQEEEERVSSSRSRLSLA
KRRVLKCRP*

DNA
ATGGCTCAAGCAGCGAGATTAAGCCTGAGAATGCAGAAAGAGCTAAAGCTTCTCCTCTCCGATCCACCTCACGGCGCTTC
GTTTCCACATCTCTCTTCCGCCGCCAATGGCTCCGGCGATTTCTCCACTTTCTCCACCATCGATGCTCAAATCGAAGGTC
CTGAAGATACTGTATATGCTAATGGAATCTTCAATTTGAAGATTCAAATCCCTGAGAGATATCCATTTCAGCCACCAATT
GTGTCGTTCGCTACACCGATTTATCACCCAAACATCGATAACAGTGGCCGGATTTGCCTTGACATTCTAAATCTCCCTCC
CAAGGGAGCTTGGCAACCATCGTTGAATATCTCGACAGTTTTGACGAGTATGAGATTGTTGCTTAGTGAACCAAATCCTG
ATGATGGATTGATGTGTGAAGTAAGCAGGGAGTATAAATACAATAGACAAACTTTTGATTATAAGGCACGAGAGATGACT
GAGAAGTATGCTAAGGTTAAAGCTGATGGATGCAGCACCAGCTTACAAATTAAGAATCATGGAGATGAGAAGTCTGGTGA
AAGTGGAAATAGTGTTAAGCTTAAGTTGACAGTGGAATCTTCTTTAAGCATAGCACATACAGTGAAACGTGAGACTGCAG
GGAGAGATGAACAAGAGGATGGCAATGGGAAAAGAAAAGCAGTGGTTGGTTTTGGCGAGGGGAATTCGTTTGGAAACGAT
GGGATTAAAAGGAGTAGGAAGAAGTTATCTCTTGCATTGCCTTCTCAATCTCAAAAGAAAGACTTGTGTGGTGAAGAAGA
GCTCACACGTGGTGTTTCAGCTGCTTGCAAAGAAAACAAAAAACCAAATTTGAATGGAAAGAAGCTTTCTCTGGGGCTGA
AGCAGCCATGTAATGATACTTTGGCGAGTTTTCGAACTTCTGCTGCGAAGAGTGACAACAATAGACTAAGCCGAAAACTG
TCCCTGAGATCACCACTTGGAGAGTTGAATGAAGTTAGCAAACCTGAGGTACTTGCGCAAACTGATATGAAACTGGAGAT
GAATCAAAATGAAGATGCAAGAAGTTTGCGAGGTGAGTTTGAGAATTCGGTATTGGAAGAAACATCAATGGCTGAATCCA
TTGTTGTTCTAGACAGTGATGATAGTGGACAAGAAGAAGAAGAAAGAGTCTCTTCTTCGAGGTCAAGATTATCACTGGCA
AAGAGGAGAGTCCTCAAATGTAGACCTTGA