Details for Arabidopsis Locus AT3G24508

Position : Chr3 ( 5`- 8930156 .. 8930544 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24508

Protein [Map View]
MMNVSLKLSFLVFILVIMSNLGSEARELAGVNEIFEIAARSSNNAGTARALQQAPPCKRDVDCSFECPKGGFCNDRLGTC
DCF*

DNA
ATGATGAACGTTTCTCTCAAACTTTCATTTCTGGTTTTTATTTTGGTCATCATGTCTAATCTTGGATCAGAAGCAAGGGA
ACTAGCCGGTGTTAACGAGATATTCGAAATTGCTGCGCGAAGTTCAAACAATGCCGGCACCGCTAGGGCCTTGCAGCAAG
CCCCACCTTGCAAGAGGGATGTTGATTGTAGCTTTGAATGTCCCAAGGGAGGATTCTGCAATGATCGTCTTGGCACATGT
GATTGTTTCTAA