Details for Arabidopsis Locus AT3G24506

Position : Chr3 ( 5`- 8928169 .. 8929329 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24506

Protein [Map View]
MTPLSISASPSPPWPLLSPPLSSSSLNRAAPSIFSPFSRINHGFSCSFIAVQRFALSRKTRKQLQVVAMAPEEEKLTRRN
PLDFPIEWERPKPGRRPDIFPKFSPMKSPLPPPMPYDPPEEEEEEEEKKEEETEDDPEKEDEDQPDNRS*

DNA
ATGACGCCGCTTTCTATATCGGCATCGCCTTCGCCGCCGTGGCCACTTCTCTCTCCGCCACTATCTTCATCGTCGTTAAA
CAGAGCTGCTCCGTCTATTTTTTCCCCTTTCTCTCGAATCAACCATGGCTTCTCGTGCTCTTTCATCGCCGTTCAACGCT
TCGCTCTAAGCCGCAAGACAAGGAAGCAGTTACAGGTGGTGGCTATGGCTCCTGAGGAAGAGAAGCTCACTCGTCGCAAT
CCTCTCGATTTCCCTATCGAATGGGAGAGACCAAAGCCAGGGAGGAGACCAGATATATTCCCAAAGTTTAGTCCTATGAA
GTCACCGTTGCCTCCTCCTATGCCTTATGATCCTCCAGAAGAAGAGGAAGAAGAGGAAGAGAAGAAAGAAGAAGAAACTG
AAGATGACCCTGAAAAGGAAGACGAGGACCAACCCGATAACCGGTCGTAA