Details for Arabidopsis Locus AT3G24460

Position : Chr3 ( 5`- 8885818 .. 8893050 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24460

Protein [Map View]
METGTSVSNNNQSIRNDSYEAIKNGSWFNQFRNGCNPWMARYVYGLIFLIANLLAWAARDYGRGALRKVTRFKNCKGGEN
CLGTDGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWFVKLIMWPALTIIPFLLPSSIIHLYGEIAHFGAGVFL
LIQLISVISFIQWLNECYQSQKDAERCRVYVMLLSTTSYTVCIVGVILMYIWYAPDSSCLLNIFFITWTLFLIQLMTSIA
LHPKVNAGYLTPALMGLYVVFICWCAIRSEPVGESCNRKAAASNRTDWLTIISFVVALLAMVIATFSTGIDSQCFQFKKD
ENDQEEEAEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWVRVVNEWLAVCVYIWMLVAPLILK
SRRQTPTGT*

DNA
ATGGAGACCGGTACAAGCGTTAGCAACAACAACCAAAGCATCAGAAACGATAGCTATGAAGCAATCAAGAATGGATCATG
GTTTAATCAGTTCCGCAACGGCTGCAATCCCTGGATGGCTAGATATGTATACGGTCTGATATTCCTCATTGCGAATCTAC
TAGCTTGGGCTGCTCGTGATTATGGTCGGGGTGCCTTAAGAAAAGTGACAAGATTCAAGAACTGTAAAGGTGGCGAAAAC
TGTTTGGGGACCGACGGTGTCTTAAGAGTTAGCTTGGGATGTTTTTTGTTCTACTTTGTTATGTTTCTTTCAACACTTGG
TACGTCGAAAACGCATTCATCAAGAGATAGATGGCATTCTGGATGGTGGTTTGTTAAGCTCATCATGTGGCCTGCCTTAA
CCATCATTCCCTTCTTGCTTCCTTCTTCCATTATTCACCTTTACGGAGAGATTGCCCATTTTGGTGCAGGGGTATTTCTC
TTAATACAGCTAATTAGTGTGATCAGTTTCATTCAATGGCTCAACGAATGCTATCAGTCCCAAAAAGATGCAGAAAGATG
CCGTGTCTATGTGATGTTACTATCAACTACTTCATACACAGTTTGCATAGTAGGAGTGATTTTGATGTACATTTGGTACG
CGCCTGATTCTTCATGTCTTCTCAATATATTCTTTATAACATGGACTTTGTTCCTCATCCAACTCATGACAAGCATCGCT
CTCCATCCTAAAGTTAATGCTGGATACTTGACTCCAGCTCTTATGGGACTCTATGTTGTGTTTATATGCTGGTGTGCCAT
TCGAAGTGAACCAGTGGGCGAAAGTTGTAATAGAAAAGCAGCAGCTTCAAACAGAACAGACTGGCTTACCATCATTAGCT
TTGTGGTTGCGCTACTTGCGATGGTTATCGCGACATTTTCGACAGGAATAGACTCCCAATGTTTCCAATTTAAGAAAGAT
GAGAACGATCAAGAAGAAGAAGCTGAAGATGATGTTCCATATGGCTATGGATTCTTTCATTTTGTGTTTGCCACAGGAGC
AATGTACTTCGCTATGCTACTCATCGGTTGGAACACTCATCATCCCATGAAAAAGTGGACGATTGACGTGGGATGGACAA
GTACTTGGGTAAGGGTTGTGAACGAGTGGCTTGCGGTTTGCGTATACATTTGGATGTTGGTGGCTCCTCTCATACTAAAG
AGCAGAAGACAAACGCCAACTGGGACTTGA