Details for Arabidopsis Locus AT3G24450

Position : Chr3 ( 5`- 8880065 .. 8881722 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24450

Protein [Map View]
MGKLQKIGRVWDCLFLPTNQCSCFCLNTLGDEEEEFEKEPLIDSSTEKSGKVMRLKDVVAADHRQTLAFHLKPKIVELKV
SMHCYGCAKKVEKHISKLDGVTWYKVELESKKVVVKGNILPVDVLESICKVKNAQLWSSP*

DNA
ATGGGAAAGCTCCAGAAGATTGGGAGAGTATGGGATTGTCTTTTTCTTCCGACAAATCAGTGTTCATGTTTTTGTCTAAA
CACTCTAGGAGATGAAGAAGAAGAGTTTGAGAAAGAGCCATTGATAGATTCTTCAACAGAGAAATCTGGGAAAGTCATGA
GGTTAAAAGATGTTGTAGCTGCTGATCATCGTCAGACTCTTGCCTTTCATCTTAAGCCTAAGATAGTGGAGCTAAAGGTG
TCAATGCATTGCTACGGATGTGCGAAGAAAGTCGAGAAGCATATTTCTAAATTAGACGGAGTGACATGGTACAAAGTGGA
GCTAGAGAGCAAGAAGGTGGTGGTGAAAGGGAACATATTGCCGGTAGATGTGTTAGAGAGTATTTGTAAAGTCAAGAATG
CTCAGCTTTGGTCTTCTCCTTGA