Details for Arabidopsis Locus AT3G24440

Position : Chr3 ( 5`- 8876027 .. 8878171 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24440

Protein [Map View]
MDSSSTKSKISHSRKTNKKSNKKHESNGKQQQQQDVDGGGGCLRSSWICKNASCRANVPKEDSFCKRCSCCVCHNFDENK
DPSLWLVCEPEKSDDVEFCGLSCHIECAFREVKVGVIALGNLMKLDGCFCCYSCGKVSQILGCWKKQLVAAKEARRRDGL
CYRIDLGYRLLNGTSRFSELHEIVRAAKSMLEDEVGPLDGPTARTDRGIVSRLPVAANVQELCTSAIKKAGELSANAGRD
LVPAACRFHFEDIAPKQVTLRLIELPSAVEYDVKGYKLWYFKKGEMPEDDLFVDCSRTERRMVISDLEPCTEYTFRVVSY
TEAGIFGHSNAMCFTKSVEILKPVDGKEKRTIDLVGNAQPSDREEKSSISSRFQIGQLGKYVQLAEAQEEGLLEAFYNVD
TEKICEPPEEELPPRRPHGFDLNVVSVPDLNEEFTPPDSSGGEDNGVPLNSLAEADGGDHDDNCDDAVSNGRRKNNNDCL
VISDGSGDDTGFDFLMTRKRKAISDSNDSENHECDSSSIDDTLEKCVKVIRWLEREGHIKTTFRVRFLTWFSMSSTAQEQ
SVVSTFVQTLEDDPGSLAGQLVDAFTDVVSTKRPNNGVMTSH*

DNA
ATGGATTCATCATCGACGAAATCGAAGATCTCACATTCACGCAAGACGAACAAAAAGTCAAACAAGAAGCACGAATCAAA
TGGGAAACAACAACAACAACAAGACGTCGATGGTGGTGGTGGGTGTTTGAGATCATCATGGATCTGCAAGAATGCATCGT
GTAGAGCTAATGTGCCTAAAGAAGATTCCTTTTGCAAGAGATGTTCTTGTTGTGTTTGTCATAATTTCGATGAAAACAAG
GATCCTAGTCTTTGGTTAGTTTGTGAGCCTGAGAAATCTGATGATGTTGAGTTCTGTGGCTTATCGTGTCACATTGAGTG
TGCTTTTCGAGAAGTCAAAGTTGGTGTTATTGCTCTTGGGAATCTGATGAAGCTTGATGGTTGTTTTTGTTGCTACTCAT
GTGGCAAAGTTTCTCAAATTCTTGGATGTTGGAAAAAGCAGCTTGTGGCAGCAAAGGAAGCACGACGACGTGATGGACTG
TGTTATAGAATAGATTTGGGTTATAGACTGTTGAATGGGACTAGTCGGTTTAGTGAATTGCATGAGATTGTTAGAGCTGC
TAAGTCTATGCTGGAGGATGAAGTTGGACCTCTTGATGGACCTACTGCTAGAACTGATAGAGGCATTGTTAGTAGGCTTC
CTGTTGCAGCTAATGTGCAAGAGCTTTGCACTTCTGCAATTAAAAAGGCAGGGGAGTTGTCAGCCAATGCAGGTAGAGAT
TTAGTTCCAGCTGCGTGCAGGTTTCATTTCGAAGATATTGCACCAAAGCAAGTGACTCTTCGTCTGATTGAGCTACCTAG
TGCTGTAGAATATGATGTTAAGGGTTACAAGTTATGGTATTTCAAGAAAGGAGAGATGCCTGAGGATGATTTATTTGTTG
ATTGCAGTAGAACTGAGAGGAGGATGGTGATATCTGACCTTGAGCCTTGCACGGAGTACACATTCCGTGTTGTCTCTTAC
ACAGAAGCTGGTATATTTGGCCATTCGAACGCTATGTGCTTTACGAAGAGCGTTGAGATATTGAAACCAGTGGATGGTAA
GGAAAAGAGAACAATTGATTTAGTAGGTAACGCTCAGCCCTCAGATAGAGAGGAGAAAAGTAGCATTTCCTCAAGATTTC
AAATTGGGCAACTTGGGAAGTATGTGCAGTTGGCTGAAGCTCAGGAGGAAGGCTTGCTTGAAGCGTTTTACAATGTAGAT
ACTGAGAAAATTTGTGAGCCGCCAGAGGAAGAATTGCCACCTCGAAGGCCACATGGGTTTGATCTAAATGTAGTTTCAGT
GCCAGACTTGAATGAGGAGTTCACTCCACCTGATTCTTCTGGAGGTGAAGACAATGGAGTGCCGCTAAATTCGCTTGCTG
AGGCTGATGGTGGTGATCATGATGATAACTGTGATGATGCTGTGTCTAACGGTAGACGGAAGAACAACAACGACTGCTTG
GTTATATCAGATGGAAGTGGTGATGATACCGGATTTGATTTCCTCATGACCAGGAAGAGGAAAGCAATTTCAGACAGTAA
TGACTCAGAGAACCACGAGTGTGACAGTTCGTCGATTGATGACACTCTTGAGAAATGTGTGAAGGTGATCAGGTGGCTGG
AGCGTGAAGGCCACATTAAAACAACATTCAGGGTCAGGTTCTTGACATGGTTCAGCATGAGCTCAACCGCTCAGGAGCAA
TCTGTTGTGAGCACATTTGTGCAGACTTTAGAGGATGATCCAGGTAGCCTTGCTGGCCAACTTGTCGACGCATTTACTGA
TGTTGTCTCCACCAAAAGGCCAAACAATGGAGTAATGACCTCACATTGA