Details for Arabidopsis Locus AT3G24430

Position : Chr3 ( 5`- 8868583 .. 8872201 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24430

Protein [Map View]
MPLLHPQSLRHPSFEIQTQRRSNSTTRLLLSHKFLHSQASIISISRTRILKRVSQNLSVAKAASAQASSSVGESVAQTSE
KDVLKALSQIIDPDFGTDIVSCGFVKDLGINEALGEVSFRLELTTPACPVKDMFENKANEVVAALPWVKKVNVTMSAQPA
KPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEMNPEKKTI
IPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVAPLTAAVIVTTPQKL
AFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDP
LSDVARTFQDLGVCVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGEQKVLYGD
VAEDIEPEDIRPMGNYAVSITWPDGFSQIAPYDQLEEIERLVDVPPLSPVEV*

DNA
ATGCCGCTTCTTCATCCACAGTCGTTGCGGCATCCTTCTTTCGAGATTCAGACCCAAAGAAGAAGCAATTCCACAACAAG
ATTGCTTCTTTCTCACAAGTTTCTCCATTCTCAAGCTTCCATTATCTCAATCTCCAGGACAAGAATCCTCAAACGGGTCT
CTCAGAATCTCTCTGTAGCTAAAGCTGCTTCAGCTCAAGCTAGTAGTAGTGTTGGTGAGAGTGTTGCTCAAACATCAGAA
AAAGATGTGTTGAAGGCTCTGTCTCAGATTATTGATCCTGATTTTGGGACAGATATTGTTTCTTGTGGTTTTGTGAAAGA
TTTGGGGATTAATGAAGCTTTGGGTGAGGTTTCGTTCCGTTTGGAGCTGACAACACCCGCATGTCCAGTCAAAGACATGT
TTGAGAACAAGGCAAATGAGGTAGTTGCAGCCCTTCCATGGGTGAAGAAGGTAAATGTGACAATGTCAGCACAACCAGCC
AAGCCCATTTTTGCAGGGCAGCTTCCCTTTGGATTATCAAGAATTTCGAACATCATCGCTGTTTCTAGTTGCAAGGGTGG
TGTTGGGAAATCAACAGTAGCTGTAAATCTTGCTTATACATTAGCTGGTATGGGTGCTAGAGTTGGTATCTTTGATGCTG
ATGTCTATGGTCCAAGTCTACCAACCATGGTCAATCCTGAGAGCCGTATATTGGAAATGAACCCGGAGAAGAAGACCATC
ATTCCAACAGAATACATGGGCGTCAAGCTAGTCTCATTTGGATTTGCAGGACAAGGGCGTGCCATTATGAGAGGTCCTAT
GGTGTCTGGTGTTATAAACCAACTCCTTACAACAACTGAATGGGGAGAGCTGGACTATCTTGTTATCGACATGCCTCCTG
GAACTGGTGATATACAACTGACCTTATGCCAGGTTGCGCCATTGACAGCAGCGGTAATTGTCACCACCCCTCAAAAGTTG
GCGTTTATTGATGTTGCAAAAGGTGTAAGGATGTTCTCAAAACTTAAGGTGCCTTGCGTTGCTGTTGTGGAGAATATGTG
CCACTTTGACGCTGATGGGAAACGTTATTACCCTTTTGGGAAAGGTTCAGGTTCTGAGGTGGTCAAGCAATTCGGCATAC
CTCACCTCTTTGACCTCCCCATTAGACCAACGTTATCTGCTTCGGGGGATAGCGGAACTCCTGAAGTAGTGTCGGATCCT
CTAAGTGACGTTGCCAGAACGTTCCAGGATCTTGGTGTATGTGTAGTGCAACAATGCGCCAAGATACGCCAGCAAGTATC
AACGGCCGTGACATACGACAAGTATCTCAAGGCAATTAGAGTGAAGGTACCAAACTCAGACGAAGAGTTCTTACTGCACC
CTGCAACCGTCAGAAGAAATGATAGATCTGCACAAAGTGTGGATGAATGGACTGGAGAGCAAAAAGTTCTATATGGCGAT
GTAGCGGAAGATATCGAACCTGAGGACATACGACCAATGGGAAACTACGCTGTCTCGATAACCTGGCCCGACGGGTTTAG
CCAGATTGCTCCATATGACCAGTTGGAAGAAATTGAAAGGCTAGTAGATGTTCCTCCATTGTCTCCAGTCGAAGTCTAG