Details for Arabidopsis Locus AT3G24320

Position : Chr3 ( 5`- 8822979 .. 8829694 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24320

Protein [Map View]
MHWIATRNAVVSFPKWRFFFRSSYRTYSSLKPSSPILLNRRYSEGISCLRDGKSLKRITTASKKVKTSSDVLTDKDLSHL
VWWKERLQTCKKPSTLQLIERLMYTNLLGLDPSLRNGSLKDGNLNWEMLQFKSRFPREVLLCRVGEFYEAIGIDACILVE
YAGLNPFGGLRSDSIPKAGCPIMNLRQTLDDLTRNGYSVCIVEEVQGPTPARSRKGRFISGHAHPGSPYVYGLVGVDHDL
DFPDPMPVVGISRSARGYCMISIFETMKAYSLDDGLTEEALVTKLRTRRCHHLFLHASLRHNASGTCRWGEFGEGGLLWG
ECSSRNFEWFEGDTLSELLSRVKDVYGLDDEVSFRNVNVPSKNRPRPLHLGTATQIGALPTEGIPCLLKVLLPSTCSGLP
SLYVRDLLLNPPAYDIALKIQETCKLMSTVTCSIPEFTCVSSAKLVKLLEQREANYIEFCRIKNVLDDVLHMHRHAELVE
ILKLLMDPTWVATGLKIDFDTFVNECHWASDTIGEMISLDENESHQNVSKCDNVPNEFFYDMESSWRGRVKGIHIEEEIT
QVEKSAEALSLAVAEDFHPIISRIKATTASLGGPKGEIAYAREHESVWFKGKRFTPSIWAGTAGEDQIKQLKPALDSKGK
KVGEEWFTTPKVEIALVRYHEASENAKARVLELLRELSVKLQTKINVLVFASMLLVISKALFSHACEGRRRKWVFPTLVG
FSLDEGAKPLDGASRMKLTGLSPYWFDVSSGTAVHNTVDMQSLFLLTGPNGGGKSSLLRSICAAALLGISGLMVPAESAC
IPHFDSIMLHMKSYDSPVDGKSSFQVEMSEIRSIVSQATSRSLVLIDEICRGTETAKGTCIAGSVVESLDTSGCLGIVST
HLHGIFSLPLTAKNITYKAMGAENVEGQTKPTWKLTDGVCRESLAFETAKREGVPESVIQRAEALYLSVYAKDASAEVVK
PDQIITSSNNDQQIQKPVSSERSLEKDLAKAIVKICGKKMIEPEAIECLSIGARELPPPSTVGSSCVYVMRRPDKRLYIG
QTDDLEGRIRAHRAKEGLQGSSFLYLMVQGKSMACQLETLLINQLHEQGYSLANLADGKHRNFGTSSSLSTSDVVSIL*

DNA
ATGCATTGGATTGCTACCAGAAACGCCGTCGTTTCATTCCCAAAATGGCGGTTCTTCTTCCGCTCCTCATATCGCACTTA
CTCTTCCCTCAAACCCTCCTCCCCAATTCTACTTAATAGAAGGTACTCTGAGGGGATATCTTGTCTCAGAGATGGAAAGT
CTTTGAAAAGAATCACAACGGCTTCTAAGAAAGTGAAGACGTCAAGTGATGTTCTCACTGACAAAGATCTCTCTCATTTG
GTTTGGTGGAAGGAGAGATTGCAGACATGTAAGAAACCATCTACTCTTCAGCTTATTGAAAGGCTTATGTACACCAATTT
ACTTGGTTTGGACCCTAGCTTGAGGAATGGAAGTTTAAAAGATGGAAACCTCAACTGGGAGATGTTGCAGTTTAAGTCAA
GGTTTCCACGCGAAGTTTTGCTCTGCAGAGTAGGAGAATTTTATGAGGCTATTGGAATAGATGCTTGTATACTTGTTGAA
TATGCTGGTCTCAATCCTTTTGGTGGTCTTCGATCAGATAGTATTCCAAAGGCTGGCTGCCCAATTATGAATCTTCGACA
GACTTTGGATGACCTGACACGCAATGGTTATTCAGTGTGTATTGTGGAGGAAGTTCAGGGGCCAACACCAGCACGCTCCC
GTAAAGGTCGATTTATTTCAGGGCATGCACATCCAGGAAGTCCTTATGTATATGGGCTTGTCGGTGTTGACCATGATCTT
GACTTTCCTGATCCTATGCCTGTTGTTGGGATATCTCGTTCAGCAAGGGGGTATTGTATGATATCTATTTTCGAGACTAT
GAAAGCATATTCGCTAGATGATGGTCTAACAGAAGAAGCCTTAGTTACCAAGCTCCGCACTCGTCGCTGTCATCATCTTT
TCTTACATGCATCGTTGAGGCACAATGCATCAGGGACGTGCCGCTGGGGAGAGTTTGGGGAAGGGGGTCTACTCTGGGGA
GAATGCAGTAGCAGGAATTTTGAATGGTTTGAAGGAGATACTCTTTCCGAGCTCTTATCAAGGGTCAAAGATGTTTATGG
TCTTGATGATGAAGTTTCCTTTAGAAATGTCAATGTACCTTCAAAAAATCGGCCACGTCCGTTGCATCTTGGAACGGCTA
CACAAATTGGTGCCTTACCTACTGAAGGAATACCTTGTTTGTTGAAGGTGTTACTTCCATCTACGTGCAGTGGTCTGCCT
TCTTTGTATGTTAGGGATCTTCTTCTGAACCCTCCTGCTTACGATATTGCTCTGAAAATTCAAGAAACGTGCAAGCTCAT
GAGCACAGTAACATGTTCAATTCCAGAGTTTACCTGCGTCTCTTCTGCTAAGCTTGTGAAGCTTCTTGAGCAACGGGAAG
CCAACTACATTGAGTTCTGTCGAATAAAAAATGTGCTTGATGATGTATTACATATGCATAGACATGCTGAGCTTGTGGAA
ATCCTGAAATTATTGATGGATCCTACCTGGGTGGCTACTGGTTTGAAAATTGACTTTGACACTTTTGTCAACGAATGTCA
TTGGGCGTCTGATACAATTGGTGAAATGATCTCTTTAGATGAGAATGAAAGTCATCAGAATGTAAGTAAATGTGACAATG
TCCCGAACGAATTCTTTTATGATATGGAGTCTTCATGGCGAGGTCGCGTTAAGGGAATTCATATAGAGGAAGAAATCACT
CAAGTAGAAAAATCAGCTGAGGCTTTATCTTTAGCAGTAGCTGAGGATTTTCACCCTATTATATCAAGAATTAAGGCCAC
CACTGCTTCACTTGGTGGCCCGAAAGGCGAAATCGCATATGCAAGAGAGCATGAGTCTGTTTGGTTCAAGGGGAAACGGT
TTACGCCATCTATCTGGGCTGGTACTGCAGGGGAAGACCAAATAAAACAGCTGAAACCTGCCTTAGACTCGAAAGGAAAA
AAGGTTGGAGAAGAATGGTTTACGACCCCAAAGGTGGAAATTGCTTTAGTCAGATACCATGAAGCTAGTGAGAATGCAAA
AGCTCGGGTGTTGGAACTGTTGCGCGAGTTATCCGTTAAATTGCAAACAAAAATAAATGTTCTTGTCTTTGCATCTATGC
TTCTGGTCATTTCAAAAGCATTATTTTCCCATGCTTGTGAAGGGAGAAGGCGAAAGTGGGTTTTTCCAACGCTTGTCGGA
TTCAGTTTAGATGAGGGCGCAAAACCATTAGATGGTGCCAGTCGAATGAAGCTGACAGGCCTGTCACCTTATTGGTTTGA
TGTATCTTCTGGAACCGCTGTTCACAATACCGTTGACATGCAATCACTGTTTCTTCTAACTGGACCTAACGGTGGTGGTA
AATCGAGTTTGCTCAGATCAATATGCGCAGCTGCTCTACTTGGAATTTCCGGTTTAATGGTTCCAGCTGAATCAGCTTGT
ATTCCTCACTTTGATTCCATCATGCTTCACATGAAATCATATGACAGCCCTGTAGACGGAAAAAGTTCTTTCCAGGTAGA
AATGTCGGAAATACGATCTATTGTAAGCCAGGCTACTTCGAGAAGCCTAGTGCTTATAGATGAGATATGCCGAGGGACAG
AGACAGCAAAAGGCACCTGTATCGCTGGTAGTGTGGTAGAGAGTCTTGACACAAGTGGTTGTTTGGGTATTGTATCTACT
CATCTCCATGGAATCTTCAGTTTACCTCTTACAGCGAAAAACATCACATATAAAGCAATGGGAGCCGAAAATGTCGAAGG
GCAAACCAAGCCAACTTGGAAATTGACAGATGGAGTCTGCAGAGAGAGTCTTGCGTTTGAAACAGCTAAGAGGGAAGGTG
TTCCCGAGTCAGTTATCCAAAGAGCTGAAGCTCTTTACCTCTCGGTCTATGCAAAAGACGCATCAGCTGAAGTTGTCAAA
CCCGACCAAATCATAACTTCATCCAACAATGACCAGCAGATCCAAAAACCAGTCAGCTCTGAGAGAAGTTTGGAGAAGGA
CTTAGCAAAAGCTATCGTCAAAATCTGTGGGAAAAAGATGATTGAGCCTGAAGCAATAGAATGTCTTTCAATTGGTGCTC
GTGAGCTTCCACCTCCATCTACAGTTGGTTCTTCATGCGTGTATGTGATGCGGAGACCCGATAAGAGATTGTACATTGGA
CAGACCGATGATCTTGAAGGACGAATACGTGCGCATCGAGCAAAGGAAGGACTGCAAGGGTCAAGTTTTCTATACCTTAT
GGTTCAAGGTAAGAGCATGGCTTGTCAGTTAGAGACTCTATTGATTAATCAACTCCATGAACAAGGCTACTCTCTGGCTA
ACCTAGCCGATGGAAAGCACCGTAATTTCGGAACGTCCTCAAGCTTGAGTACATCAGACGTAGTCAGCATCTTATAG