Details for Arabidopsis Locus AT3G24280

Position : Chr3 ( 5`- 8798934 .. 8799401 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24280

Protein [Map View]
MDRYWEQDPMRPMVYRDFLGEMEYPGYSMPMQMEIDEDDFGPMDMQFEVGGISPFQMKPEDSDFFNKFEDDFDDSDIN*

DNA
ATGGATAGATATTGGGAACAAGACCCGATGAGGCCGATGGTGTACCGTGACTTTCTGGGTGAGATGGAGTATCCAGGATA
CTCGATGCCTATGCAGATGGAGATCGATGAAGACGACTTCGGGCCCATGGATATGCAGTTTGAAGTTGGAGGAATTTCAC
CCTTTCAAATGAAGCCCGAAGACAGCGATTTCTTCAACAAGTTCGAGGATGATTTTGATGATTCCGATATCAATTAG