Details for Arabidopsis Locus AT3G24060

Position : Chr3 ( 5`- 8689589 .. 8690032 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G24060

Protein [Map View]
MNTRKTIILLLFMLIAISLTIIFTLMLQPQTMFLGEEFDVRVINSFRDNSSLPLVIWCTSPQGDLGGRALQEGDDFEWTA
KIDLWSWMAEYTCTMKWDSKRKQFEAFKVSRDSNRCGSTKKCSWSVREDGFYFSSDEVYWTKDFSWL*

DNA
ATGAACACTCGAAAAACAATCATTCTTCTTCTGTTTATGCTTATCGCCATCTCCTTAACGATCATCTTCACGTTGATGCT
TCAGCCACAAACTATGTTTCTAGGAGAAGAATTCGACGTGCGTGTGATCAACAGCTTCAGAGACAACTCTTCTCTCCCTC
TAGTTATCTGGTGCACTTCGCCGCAAGGAGATCTCGGTGGTCGTGCGCTTCAAGAAGGTGATGACTTCGAATGGACGGCC
AAGATCGATTTGTGGTCATGGATGGCAGAGTACACATGTACAATGAAGTGGGATTCAAAGAGGAAACAGTTCGAGGCGTT
TAAGGTTTCTAGAGACAGCAATAGATGTGGATCTACTAAGAAGTGTTCTTGGTCCGTTAGAGAAGATGGATTTTATTTTA
GTAGTGATGAGGTTTATTGGACCAAGGATTTTTCTTGGTTATAA