Details for Arabidopsis Locus AT3G23900

Position : Chr3 ( 5`- 8631584 .. 8636059 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23900

Protein [Map View]
MASDRGSAASGGKPIWMKHAEDAKIKDEGEKDAAAKAAFEATFKGVDQTTHLIEPVAPVPESAPESDSDSDDDDDDESDY
LSRKPIGPVDPSKSTASGAGIGGGTACVPSTFVVVTKDSDGRKVPNGGALIRVKVSPGVGVGGTDQEGVVKDVGDGSYAV
TYVVPKRGNYMVNIECNGNAIMGSPFPVFFSQGSSSTGLMGSAPASYSNLINQTMPNMPNYTGSVSGAFPGLLGMVPGIA
SGPSGGAILPGVGASLGEVCREYLNGRCVNSMCKLNHPPQNLLMTAIAATTSMGNLSQVPMAPSAAAMAAAQAIVAAQAL
QAHASQMQAQAQSNKGSLGSPEKGENGDLKKFLQVSNLSPSLTTEQLRQLFSFCGTVVDCSITDSKHIAYIEYSNSEEAT
AALALNNTEVFGRALNVEIAKSLPHKPSSNNSSSSLPLMMQQAVAMQQMQFQQAILMQQAVATQQAANRAATMKSATELA
AARAAEISRKLRPDGVGNDEKEADQKSRSPSKSPARSRSKSKSPISYRRRRRSPTYSPPFRRPRSHRSRSPLRYQRRSTY
EGRRRSYRDSRDISESRRYGRSDEHHSSSSRRSRSVSPKKRKSGQEDSELSRLRRDSSSRGEKKSSRAGSRSPRRRKEVK
STPRDDEENKVKRRTRSRSRSVEDSADIKDKSRDEELKHHKKRSRSRSREDRSKTRDTSRNSDEAKQKHRQRSRSRSLEN
DNGSHENVDVAQDNDLNSRHSKRRSKSLDEDYDMKERRGRSRSRSLETKNRSSRKNKLDEDRNTGSRRRRSRSKSVEGKR
SYNKETRSRDKKSKRRSGRRSRSPSSEGKQGRDIRSSPGYSDEKKSRHKRHSRSRSIEKKNSSRDKRSKRHERLRSSSPG
RDKRRGDRSLSPVSSEDHKIKKRHSGSKSVKEKPHSDYEKVDDGDANSDSSQQERNLEGHLLSLDSMSSQDVEKSKENPP
SSSSVERGDANDDEKFKIEEKRIILKS*

DNA
ATGGCTTCAGATCGTGGTTCTGCAGCTTCTGGTGGTAAGCCCATTTGGATGAAACATGCGGAAGATGCAAAAATCAAAGA
CGAAGGAGAGAAAGACGCTGCGGCAAAAGCAGCTTTTGAAGCTACATTCAAAGGTGTAGACCAAACTACACATTTGATTG
AACCTGTTGCACCGGTACCGGAATCCGCACCGGAATCTGATAGTGATTCAGATGATGATGATGATGATGAATCTGATTAC
TTGTCTAGGAAACCAATTGGTCCTGTGGATCCGAGTAAGTCTACAGCTTCTGGTGCTGGTATTGGTGGTGGAACGGCTTG
TGTTCCGTCTACGTTTGTTGTTGTAACTAAGGATTCTGATGGGAGGAAAGTTCCAAATGGTGGAGCTTTGATTAGAGTTA
AAGTGTCTCCTGGTGTTGGTGTTGGTGGTACTGATCAAGAAGGTGTGGTTAAAGATGTTGGTGATGGGAGTTATGCTGTT
ACTTATGTTGTGCCTAAGAGAGGAAACTATATGGTTAATATTGAATGCAATGGGAATGCTATCATGGGAAGTCCCTTTCC
TGTCTTCTTTAGCCAAGGGTCTTCTTCTACTGGACTGATGGGTTCTGCTCCAGCTTCATACTCGAATCTTATAAATCAAA
CAATGCCAAACATGCCTAATTACACTGGTTCTGTTTCGGGTGCTTTCCCGGGGTTGTTGGGGATGGTTCCAGGGATTGCA
TCTGGTCCTTCAGGTGGTGCTATTTTGCCTGGAGTTGGAGCTTCACTTGGGGAAGTTTGTCGAGAATATCTTAATGGTAG
ATGTGTGAACTCTATGTGCAAGTTAAACCACCCTCCTCAGAATTTGCTGATGACTGCTATAGCTGCAACGACAAGTATGG
GTAACCTTAGTCAGGTGCCTATGGCTCCTTCTGCTGCTGCAATGGCTGCTGCGCAGGCTATTGTTGCTGCACAGGCTCTT
CAAGCTCATGCTTCTCAGATGCAAGCACAGGCTCAATCAAACAAGGGATCTTTAGGTTCCCCAGAAAAAGGAGAAAACGG
GGATTTGAAGAAATTTCTCCAAGTTAGCAACCTAAGTCCATCGCTTACAACTGAACAACTTAGGCAGCTATTTAGCTTCT
GTGGCACAGTAGTTGACTGTAGTATAACTGATTCAAAGCATATCGCCTACATAGAATACTCGAATTCCGAAGAAGCAACA
GCTGCTTTGGCATTAAACAATACGGAAGTCTTTGGTAGAGCATTGAATGTTGAGATTGCAAAATCGCTACCTCACAAACC
ATCTTCAAATAATTCTTCGTCCTCACTACCACTGATGATGCAACAGGCCGTCGCGATGCAGCAGATGCAATTCCAGCAGG
CTATACTAATGCAACAAGCCGTGGCTACTCAGCAGGCAGCAAATAGAGCTGCCACAATGAAGTCTGCCACTGAGCTTGCA
GCAGCTAGAGCTGCAGAGATAAGTAGGAAACTGAGACCTGATGGAGTTGGAAATGATGAAAAAGAAGCTGATCAGAAGTC
TAGGTCACCATCTAAGTCTCCTGCAAGGTCGAGATCAAAGTCAAAATCACCAATAAGTTACAGGCGAAGACGGAGATCTC
CAACCTATTCACCACCGTTTCGTCGCCCAAGAAGTCACAGATCGAGATCACCATTAAGATATCAACGGCGATCAACTTAT
GAAGGGAGAAGGCGGTCATATAGAGATTCTAGGGATATTTCTGAAAGTAGGAGATACGGTAGATCAGATGAACACCATTC
TTCTAGTTCAAGGAGAAGTAGGAGTGTAAGCCCTAAAAAGAGAAAATCTGGACAAGAAGATTCAGAGCTGTCAAGACTTC
GACGAGATAGCTCATCACGTGGAGAGAAGAAATCATCTCGTGCTGGTTCACGATCACCAAGGCGACGTAAGGAAGTTAAG
TCAACCCCAAGAGATGATGAGGAAAACAAAGTGAAACGTAGAACACGTTCAAGATCTAGATCAGTGGAAGATTCTGCAGA
TATAAAGGATAAATCTAGAGATGAGGAATTGAAACATCACAAAAAGCGGTCGAGGTCAAGATCTCGTGAAGATAGGAGTA
AAACCAGAGACACATCTCGAAATTCTGATGAAGCTAAACAGAAACACCGGCAGAGGTCTAGGTCCAGATCATTGGAAAAT
GACAATGGATCTCATGAGAATGTTGATGTTGCTCAAGACAATGATCTAAATTCCCGTCACAGTAAGCGCAGGTCAAAATC
ATTGGACGAGGACTATGATATGAAAGAGAGGAGGGGAAGGTCCAGGTCCAGATCATTGGAAACGAAAAACAGGTCTTCTA
GGAAGAATAAGCTGGATGAAGACAGAAACACAGGATCACGTCGAAGGAGGTCCAGGTCAAAATCAGTGGAAGGTAAGCGC
AGTTATAACAAGGAGACTCGAAGCAGGGACAAAAAGTCCAAGCGTCGTAGTGGAAGACGGTCGAGGTCACCATCATCTGA
GGGTAAGCAAGGGAGAGATATCAGGTCATCCCCTGGATATTCTGATGAAAAGAAATCAAGACATAAACGGCACTCCAGGT
CAAGATCAATAGAGAAAAAGAACAGTTCAAGAGATAAAAGGTCAAAACGTCATGAAAGATTGCGGTCATCATCTCCTGGA
CGTGACAAAAGACGGGGCGATAGATCATTATCTCCTGTTAGTTCAGAGGATCATAAGATCAAGAAAAGACACTCTGGATC
AAAATCTGTGAAAGAGAAACCCCACTCAGATTATGAGAAAGTTGACGATGGAGATGCAAATTCAGATTCTAGTCAGCAGG
AAAGGAATCTTGAAGGTCATTTATTGTCATTGGATTCGATGTCATCACAGGATGTGGAGAAGTCAAAAGAGAATCCACCA
TCTAGCAGCTCAGTGGAAAGAGGTGATGCAAATGATGATGAGAAGTTTAAGATTGAGGAGAAAAGGATTATTCTTAAGTC
ATAG