Details for Arabidopsis Locus AT3G23810

Position : Chr3 ( 5`- 8587664 .. 8589713 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23810

Protein [Map View]
MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMTIQTAVLIETLTALGAE
VRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKN
GTFPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDN
LYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQALMEGLQVLTLEDVVSEADI
FCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGC
ATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKP
VHYRY*

DNA
ATGGCTTTGCTTGTAGAGAAAACCTCAAGTGGCCGTGAATACAAGGTCAAGGACATGTCCCAAGCCGACTTCGGCCGTCT
CGAAATCGAGCTAGCCGAAGTCGAAATGCCTGGACTTGTCTCTTGCGTTACCGAATTCGGACCATCTCAGCCACTCAAAG
GAGCAAGAATCACCGGTTCTCTCCACATGACGATCCAAACCGCGGTTTTAATCGAAACCTTAACCGCTCTCGGCGCTGAA
GTCAGATGGTGTTCTTGCAACATCTTCTCCACTCAAGACCACGCCGCGGCCGCTATTGCTCGTGATTCCGCCGCGGTGTT
CGCTTGGAAAGGTGAGACTCTTCAAGAATATTGGTGGTGTACAGAGAGAGCTCTTGACTGGGGTCCTGGAGGTGGTCCTG
ATCTCATCGTTGATGACGGTGGTGATGCTACACTGTTGATCCATGAAGGAGTTAAAGCTGAAGAGATCTTTGCCAAGAAT
GGTACGTTCCCTGACCCGACCTCTACTGATAATCCCGAGTTTCAGATCGTCCTGTCTATTATCAAAGACGGTCTTCAAGT
TGATCCCAAGAAGTACCATAAGATGAAGGAGAGATTGGTTGGTGTCTCTGAGGAGACTACTACTGGTGTTAAGAGGCTTT
ATCAGATGCAGGAGACTGGAGCTCTCTTGTTCCCTGCCATTAACGTCAATGACTCTGTCACCAAGAGCAAGTTTGACAAC
TTGTACGGATGCCGACACTCGCTTCCCGATGGTCTCATGAGGGCTACTGATGTTATGATTGCTGGAAAGGTTGCTGTTAT
CTGTGGTTATGGTGATGTAGGAAAAGGTTGTGCTGCAGCAATGAAAACCGCGGGTGCTCGTGTCATAGTGACTGAGATTG
ATCCAATCTGTGCTCTTCAGGCTCTTATGGAAGGTCTTCAAGTTCTGACCCTTGAGGATGTTGTCTCAGAAGCTGATATC
TTCTGTACCACTACTGGTAACAAAGATATTATTATGGTTGATCACATGAGGAAGATGAAGAACAATGCCATTGTCTGTAA
CATTGGTCATTTTGACAATGAAATCGACATGCTTGGACTTGAGACCTACCCTGGTGTGAAACGTATTACCATCAAGCCAC
AGACCGATAGGTGGGTGTTTCCTGATACCAACTCTGGCATCATTGTTCTAGCTGAAGGTCGTTTGATGAACTTGGGATGC
GCCACTGGACACCCGAGTTTCGTGATGTCGTGCTCATTCACCAACCAGGTGATTGCACAGCTTGAGCTCTGGAACGAGAA
GTCAAGCGGGAAGTATGAGAAGAAGGTCTATGTTTTGCCTAAACACTTGGATGAGAAGGTAGCTGCACTTCACTTAGGCA
AGCTTGGTGCAAGACTCACCAAGCTTACCAAGGACCAATCTGACTATGTCAGCATACCCGTTGAAGGTCCTTACAAGCCT
GTTCACTACAGGTACTGA