Details for Arabidopsis Locus AT3G23800

Position : Chr3 ( 5`- 8581654 .. 8583835 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23800

Protein [Map View]
MEAAMNNHDGDCCKSGPGYATPLLAMSGPREKLIYVAAIYTGTGQAKPDYLATVDVEPSSSTYSSVIHRLPMPYLEDELH
HSGWNSCSSCYGDSSCERRYLILPSLLSGRIYVIDTKTNPREPSLHKFVDPAEVLEKTGLAYPHQPHCLASGDVLVSCLG
DEDGNAEGSGFLLLDSEFNIKGRWEKDGNSPLYGYDFWYQPRHKTMISTSWGAPAAFTKGFDLKDVSDGLYGKHLHVYSW
PQGELKQILDLGDTGLLPLEVRFLHEPDKATGFAGCALSSTLVRFFKNDDETWSHEVAISVEPLKVENWILPEMPGLITD
FLISLDDRFLYCSNWLHGDIRQYNIEDPKTPVLTGQIHVGGLVQKGSLVLALGEEGKAFQFDVPKIKGQRLRGGPQMFQL
SLDGKRLYVTNSLFSVWDRQFYPELVEKGSHMLQIDVDTDKGGLSINPNFFVDFGTEPDGPSLAHEMRYPGGDCTSDIWV
*

DNA
ATGGAAGCGGCGATGAACAACCACGATGGAGACTGCTGCAAGAGCGGGCCGGGTTATGCGACACCCCTCCTCGCGATGTC
TGGTCCACGAGAAAAACTCATCTATGTTGCTGCCATATACACTGGAACCGGGCAAGCGAAGCCAGATTACTTAGCTACTG
TGGATGTGGAACCGAGTTCATCCACATACTCGAGTGTTATCCACAGATTACCAATGCCTTACCTTGAAGATGAACTTCAT
CACTCAGGCTGGAACTCATGTAGCTCTTGCTATGGTGATTCTTCTTGCGAGAGACGTTATCTCATCTTGCCTTCTCTTCT
GTCTGGTCGTATTTACGTGATCGATACGAAAACAAACCCGAGGGAACCATCTTTGCACAAATTCGTGGACCCTGCAGAGG
TTTTGGAGAAGACGGGGTTGGCTTATCCGCATCAGCCTCATTGCTTAGCTTCCGGAGACGTTCTTGTGTCTTGTCTTGGA
GACGAAGATGGAAACGCAGAAGGCAGTGGGTTTCTCTTACTTGATTCCGAGTTTAACATCAAAGGAAGGTGGGAGAAGGA
TGGAAACAGTCCTTTGTATGGGTATGATTTCTGGTACCAACCTCGGCATAAGACGATGATCAGTACCTCATGGGGAGCCC
CGGCCGCGTTTACCAAAGGATTTGACCTCAAAGACGTCTCTGATGGCTTATATGGAAAGCATCTACATGTCTATAGCTGG
CCCCAAGGAGAATTGAAACAGATTCTTGACCTTGGTGATACCGGACTTTTACCCTTAGAGGTAAGATTCTTGCATGAGCC
GGATAAAGCTACGGGATTTGCAGGGTGTGCGTTGTCGAGTACTTTAGTAAGATTTTTCAAGAACGATGATGAAACATGGA
GCCACGAGGTGGCTATATCAGTTGAACCTCTGAAAGTTGAAAACTGGATTCTCCCAGAAATGCCAGGGCTTATCACCGAC
TTTCTAATCTCACTTGACGACCGATTCCTCTATTGTTCCAACTGGCTTCATGGAGATATTCGTCAGTACAACATCGAGGA
CCCGAAAACCCCTGTTTTAACTGGTCAAATACATGTAGGCGGGCTAGTCCAAAAGGGAAGTCTTGTCTTGGCCTTAGGAG
AAGAAGGAAAAGCATTTCAGTTTGATGTCCCTAAGATCAAGGGTCAGCGTCTAAGAGGAGGTCCTCAGATGTTTCAGCTG
AGCCTAGATGGGAAGCGATTGTACGTGACGAACTCGCTGTTTAGTGTTTGGGACAGACAGTTTTACCCGGAACTTGTGGA
GAAAGGGTCACACATGTTGCAGATAGATGTTGATACAGATAAAGGTGGTCTCTCCATAAACCCTAACTTCTTCGTCGACT
TTGGGACCGAACCGGATGGTCCTTCGCTCGCTCACGAGATGAGATATCCGGGTGGCGACTGCACCTCAGATATCTGGGTT
TAG