Details for Arabidopsis Locus AT3G23790

Position : Chr3 ( 5`- 8575167 .. 8581112 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23790

Protein [Map View]
MASTSLGASILVSHCSSAPEFQVSGMRLVFGYKAFGCRTSRRGFRVRCESKIQEKELRRCSPFLERLSLPREAALSSNEW
KSVPDIWRSSVEKYGDRVAVVDPYHDPPSTFTYRQLEQEILDFVEGLRVVGVKADEKIALFADNSCRWLVADQGIMATGA
VNVVRGSRSSVEELLQIYCHSESVALVVDNPEFFNRIAESFSYKAAPKFVILLWGEKSSLVTAGRHTPVYSYNEIKKFGQ
ERRAKFARSNDSGKYEYEYIDPDDIATIMYTSGTTGNPKGVMLTHQNLLHQIRNLSDFVPAEAGERFLSMLPSWHAYERA
CEYFIFTCGVEQKYTSIRFLKDDLKRYQPHYLISVPLVYETLYSGIQKQISASSPARKFLALTLIKVSLAYTEMKRVYEG
LCLTKNQKPPMYIVSLVDWLWARVVAFFLWPLHMLAEKLVHRKIRSSIGITKAGVSGGGSLPMHVDKFFEAIGVNVQNGY
GLTETSPVVSARRLRCNVLGSVGHPIKDTEFKIVDHETGTVLPPGSKGIVKVRGPPVMKGYYKNPLATKQVIDDDGWFNT
GDMGWITPQHSTGRSRSCGGVIVLEGRAKDTIVLSTGENVEPLEIEEAAMRSNLIQQIVVIGQDQRRLGAIVIPNKEAAE
GAAKQKISPVDSEVNELSKETITSMVYEELRKWTSQCSFQVGPVLIVDEPFTIDNGLMTPTMKIRRDKVVDQYKNEIERL
YK*

DNA
ATGGCTTCAACGTCTCTCGGAGCTTCGATTCTCGTTTCTCACTGCTCCTCAGCTCCTGAATTTCAAGTTTCTGGGATGAG
ATTGGTGTTTGGTTACAAGGCTTTTGGCTGCAGAACTTCACGCAGGGGATTTCGAGTTCGCTGCGAATCCAAGATTCAGG
AGAAGGAGTTAAGGCGGTGTTCGCCATTCTTAGAACGCTTATCATTGCCAAGGGAGGCTGCTTTGAGCTCTAATGAATGG
AAGTCTGTTCCTGATATTTGGAGATCATCTGTGGAGAAGTACGGTGACAGAGTTGCGGTGGTAGATCCGTATCATGACCC
GCCTTCTACATTCACGTACAGACAGTTGGAACAAGAAATCTTGGACTTTGTTGAGGGTTTACGAGTCGTTGGAGTGAAAG
CAGACGAGAAGATTGCACTTTTTGCTGATAACTCCTGTCGATGGCTTGTTGCGGATCAAGGTATAATGGCCACAGGAGCA
GTCAATGTTGTTAGAGGATCCAGATCGTCTGTGGAAGAGTTATTGCAGATATACTGTCATTCGGAAAGTGTAGCCCTTGT
TGTGGATAACCCTGAGTTTTTCAATCGCATTGCGGAGTCATTTTCTTACAAGGCAGCTCCAAAATTTGTGATTCTTCTCT
GGGGGGAAAAATCGTCGTTGGTTACAGCGGGTAGGCACACACCAGTCTATAGTTACAACGAAATTAAAAAGTTTGGACAA
GAGAGACGTGCAAAATTTGCAAGATCTAATGATTCTGGGAAGTATGAATATGAATACATCGATCCAGATGATATAGCCAC
AATTATGTATACCAGTGGAACCACAGGAAATCCAAAAGGTGTTATGCTCACACATCAGAATTTGTTACACCAGATAAGAA
ACTTGTCCGATTTTGTGCCTGCGGAAGCTGGGGAAAGATTTCTGAGTATGTTGCCATCATGGCATGCTTATGAACGGGCT
TGTGAATACTTCATATTTACATGTGGAGTTGAGCAAAAGTATACGTCTATAAGATTCTTAAAGGATGATCTCAAGCGTTA
TCAACCACACTATCTTATTTCAGTTCCTTTAGTATATGAGACACTCTACAGCGGGATTCAAAAGCAAATTTCTGCAAGCT
CCCCTGCTCGTAAATTTTTGGCACTTACATTGATCAAAGTCAGCCTGGCATATACGGAAATGAAAAGAGTTTATGAGGGT
CTTTGTTTGACAAAAAATCAAAAGCCTCCAATGTATATTGTTTCGTTGGTGGATTGGTTGTGGGCGAGAGTAGTTGCATT
TTTCCTATGGCCATTGCATATGTTGGCTGAAAAGCTTGTACACAGAAAAATTCGTTCGTCTATTGGGATAACAAAGGCTG
GTGTTAGTGGAGGTGGTAGTTTACCTATGCATGTTGACAAGTTTTTTGAGGCCATCGGTGTGAATGTACAAAATGGGTAT
GGTTTGACAGAAACCTCACCGGTTGTCTCTGCGCGGAGGCTTAGGTGTAACGTTCTTGGCTCAGTTGGGCATCCTATTAA
AGATACAGAGTTCAAAATTGTAGATCATGAGACTGGTACTGTTCTTCCACCTGGTTCAAAGGGCATTGTCAAAGTCAGAG
GCCCACCGGTGATGAAAGGTTACTACAAGAATCCACTGGCCACCAAGCAGGTTATAGATGACGATGGATGGTTCAATACT
GGAGATATGGGTTGGATTACTCCTCAGCACTCAACAGGACGGAGTCGTAGCTGTGGAGGTGTCATCGTTCTTGAAGGGCG
TGCCAAGGACACTATCGTGCTTTCCACAGGTGAAAATGTGGAACCATTGGAGATTGAAGAAGCGGCCATGAGAAGCAATT
TGATTCAACAAATAGTGGTTATTGGACAGGATCAACGCCGCCTTGGAGCTATTGTTATCCCAAACAAAGAAGCAGCAGAA
GGAGCAGCAAAGCAGAAAATTTCACCTGTAGATTCTGAAGTCAATGAACTTAGCAAGGAGACGATAACAAGCATGGTCTA
TGAAGAACTAAGGAAATGGACGTCACAATGCTCGTTCCAAGTTGGACCAGTTCTGATCGTGGATGAACCATTCACGATAG
ACAACGGTTTAATGACACCGACAATGAAAATAAGACGGGACAAGGTGGTTGATCAATACAAGAATGAAATAGAAAGACTC
TACAAGTAG