Details for Arabidopsis Locus AT3G23750

Position : Chr3 ( 5`- 8558332 .. 8561428 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23750

Protein [Map View]
MEAPTPLLLLVLLTTITFFTTSVADDQTAMLALAKSFNPPPSDWSSTTDFCKWSGVRCTGGRVTTISLADKSLTGFIAPE
ISTLSELKSVSIQRNKLSGTIPSFAKLSSLQEIYMDENNFVGVETGAFAGLTSLQILSLSDNNNITTWSFPSELVDSTSL
TTIYLDNTNIAGVLPDIFDSLASLQNLRLSYNNITGVLPPSLGKSSIQNLWINNQDLGMSGTIEVLSSMTSLSQAWLHKN
HFFGPIPDLSKSENLFDLQLRDNDLTGIVPPTLLTLASLKNISLDNNKFQGPLPLFSPEVKVTIDHNVFCTTKAGQSCSP
QVMTLLAVAGGLGYPSMLAESWQGDDACSGWAYVSCDSAGKNVVTLNLGKHGFTGFISPAIANLTSLKSLYLNGNDLTGV
IPKELTFMTSLQLIDVSNNNLRGEIPKFPATVKFSYKPGNALLGTNGGDGSSPGTGGASGGPGGSSGGGGSKVGVIVGVI
VAVLVFLAILGFVVYKFVMKRKYGRFNRTDPEKVGKILVSDAVSNGGSGNGGYANGHGANNFNALNSPSSGDNSDRFLLE
GGSVTIPMEVLRQVTNNFSEDNILGRGGFGVVYAGELHDGTKTAVKRMECAAMGNKGMSEFQAEIAVLTKVRHRHLVALL
GYCVNGNERLLVYEYMPQGNLGQHLFEWSELGYSPLTWKQRVSIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMR
AKVADFGLVKNAPDGKYSVETRLAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMEILTGRKALDDSLPDERSHLVTWFRR
ILINKENIPKALDQTLEADEETMESIYRVAELAGHCTAREPQQRPDMGHAVNVLGPLVEKWKPSCQEEEESFGIDVNMSL
PQALQRWQNEGTSSSTMFHGDFSYSQTQSSIPPKASGFPNTFDSADGR*

DNA
ATGGAGGCTCCTACGCCTCTCCTCCTTCTCGTCCTCCTCACAACCATAACCTTCTTCACCACCTCCGTCGCTGATGACCA
AACAGCAATGCTCGCTTTAGCTAAATCATTCAATCCTCCGCCGTCAGATTGGTCTTCCACCACCGATTTCTGCAAATGGT
CCGGCGTACGATGTACCGGCGGTCGTGTCACAACCATCAGCCTCGCTGATAAATCTCTCACCGGATTCATCGCACCTGAG
ATCTCGACTCTTTCAGAGCTCAAATCTGTTTCTATTCAACGTAACAAACTCTCCGGTACAATCCCTTCGTTTGCTAAACT
CTCGTCTCTTCAAGAGATCTATATGGATGAGAATAATTTCGTCGGAGTTGAAACCGGAGCTTTCGCCGGACTTACTAGTC
TCCAGATCTTGAGTTTAAGCGATAACAACAACATTACTACTTGGAGTTTCCCATCGGAGCTCGTCGATTCGACTTCTCTC
ACTACGATTTATCTCGATAACACAAACATCGCCGGAGTTTTGCCTGACATTTTCGATTCCTTAGCTTCTCTTCAAAATCT
CCGGTTATCTTACAACAACATCACCGGCGTTTTACCACCGTCGCTTGGAAAATCTTCGATTCAGAATCTTTGGATCAACA
ATCAAGACCTAGGAATGTCAGGAACGATCGAAGTTCTTTCGAGTATGACGTCCTTGTCACAAGCTTGGCTTCACAAGAAT
CACTTCTTTGGACCGATTCCAGATCTCTCCAAGAGCGAGAATCTCTTCGATCTACAGCTCCGGGATAATGATTTAACCGG
AATAGTACCTCCGACGCTTCTTACACTCGCTAGCTTGAAGAATATTTCTCTAGATAACAATAAATTTCAAGGACCTCTTC
CTTTGTTTTCACCGGAGGTTAAAGTAACAATAGACCACAACGTTTTTTGTACTACTAAAGCTGGACAAAGCTGTAGTCCT
CAGGTGATGACGCTTTTAGCGGTGGCTGGAGGTTTGGGATATCCTTCAATGTTGGCTGAGTCTTGGCAAGGTGATGATGC
TTGTAGTGGTTGGGCTTATGTTAGTTGTGATTCAGCTGGGAAGAATGTTGTCACGTTGAATCTTGGGAAACATGGATTCA
CCGGGTTTATATCTCCGGCGATTGCGAATCTTACTTCATTGAAGAGTCTTTATCTTAATGGTAACGATTTGACTGGTGTT
ATTCCTAAGGAGTTGACATTTATGACTAGTTTGCAGTTAATTGATGTCTCGAATAACAATCTTAGAGGGGAGATACCTAA
GTTTCCGGCTACGGTGAAGTTTAGTTACAAACCGGGGAATGCTTTGTTGGGAACTAATGGTGGAGATGGTTCGAGTCCTG
GAACTGGTGGTGCTAGTGGTGGTCCTGGTGGGTCTTCTGGTGGTGGTGGTAGTAAGGTTGGTGTGATTGTTGGTGTGATT
GTGGCGGTTTTAGTGTTTCTTGCCATTTTAGGATTTGTGGTTTATAAATTTGTTATGAAGAGGAAGTATGGGAGGTTTAA
TAGGACGGATCCTGAGAAGGTTGGGAAGATTTTGGTTAGTGATGCTGTATCTAATGGTGGTAGTGGTAATGGTGGATATG
CTAATGGGCATGGAGCTAATAACTTCAATGCTTTGAATAGTCCTAGTAGTGGTGACAATAGTGATCGTTTCCTTCTTGAA
GGTGGAAGTGTTACCATTCCAATGGAGGTTCTTCGCCAGGTTACAAATAATTTCAGTGAGGATAACATATTGGGCAGAGG
GGGTTTCGGTGTCGTGTATGCTGGAGAATTACACGATGGAACAAAGACTGCTGTTAAGAGGATGGAATGTGCAGCAATGG
GTAATAAAGGAATGAGCGAGTTTCAGGCTGAGATAGCGGTACTTACTAAGGTCAGGCATAGACATTTGGTTGCTCTATTG
GGTTACTGTGTGAACGGGAACGAGAGGTTGCTTGTCTATGAGTACATGCCACAGGGAAATCTTGGACAGCATTTGTTTGA
GTGGAGTGAACTCGGTTACTCTCCTTTGACATGGAAACAGAGAGTGAGCATTGCTTTAGACGTGGCAAGAGGTGTGGAAT
ATCTCCATAGCTTGGCTCAACAAAGCTTCATCCACAGAGATTTAAAGCCCTCTAACATCCTTCTAGGAGATGACATGAGA
GCCAAGGTTGCTGATTTTGGATTGGTCAAGAACGCACCTGATGGTAAATACTCTGTTGAAACAAGATTAGCAGGCACATT
CGGTTATCTAGCACCAGAATACGCCGCTACTGGAAGAGTAACGACGAAAGTGGATGTGTATGCATTTGGTGTGGTTCTCA
TGGAAATACTAACTGGAAGAAAAGCTTTAGATGATTCATTACCAGACGAGAGATCTCATCTAGTCACATGGTTCAGAAGA
ATCCTAATCAACAAAGAAAACATCCCAAAGGCACTCGACCAAACCTTAGAAGCAGACGAGGAAACAATGGAGAGCATTTA
CAGAGTTGCTGAGCTAGCTGGACACTGCACAGCCCGCGAACCTCAACAAAGACCCGACATGGGCCACGCAGTAAACGTGC
TAGGTCCACTTGTAGAGAAGTGGAAACCGTCGTGCCAAGAAGAAGAAGAGAGTTTCGGAATCGATGTGAACATGAGTTTA
CCTCAAGCTCTACAAAGATGGCAAAACGAAGGAACATCGTCATCAACAATGTTCCATGGAGACTTCTCTTATTCTCAGAC
ACAGTCTAGTATTCCTCCTAAAGCCTCTGGCTTTCCTAATACTTTCGATTCAGCTGATGGTCGGTGA