Details for Arabidopsis Locus AT3G23740

Position : Chr3 ( 5`- 8551772 .. 8554745 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23740

Protein [Map View]
MAESNQIPRKRMRFSSSPATEILPQRKSQNQRIATTVSQSRNRSSVHHSPSLYQKIDSKITPTYPRATIKDIRLRRVFSP
TPISTDCECNCKDKNQTKRQNHECLCDCDNSNSDDFAQTTPPDSELLAISEEINGSVVNKSDTNLWRKSVLLPCSRPKIF
KNTGPFSYKRLLPYLMQASDDGTSSSSRCSKSLSQNITKPVSQSMDSVYDKDSTGSFCRDTSPLKSVIASTPNKNAAFSR
GKLFKTPGSVNYRRMLPYLKDIQEDNPYPQKNTEEVISSPMLNSESDNEGTQEVVTSNVTRESGTSSDENEEPLPCERVP
VNLEQSDPDKEQETQIKHVIPDTENNLGSEIPLSSPLVGSRSSSEVNSSALHNTFVDNLVGEENMNGAEITEAKISAEEL
EAHSSDATAELVDPSVILATPSSFSPSKGILKRSMRGCRGICSCLNCSSFRLHAERAFEFSRNQLQDTEVMVLDLVGEIS
HLRDLLEKYNSADHSEPYKSQAGEASKRACEAAELAKSRLHQMNDDLQIHYRIPNEQRARVKFAHYIHEKTIVKASEPNK
LISRSP*

DNA
ATGGCGGAATCAAATCAAATCCCTCGGAAGAGAATGCGATTCTCGTCTTCTCCAGCTACAGAGATCCTCCCTCAAAGAAA
ATCACAAAACCAACGAATCGCAACCACCGTATCTCAAAGCAGAAACCGATCTAGCGTCCATCATTCACCATCACTCTATC
AAAAAATCGATTCTAAAATCACACCTACGTATCCACGAGCCACCATCAAAGATATTCGTCTCCGACGCGTCTTCTCTCCA
ACTCCGATCTCCACCGACTGCGAATGTAACTGCAAAGATAAAAATCAAACCAAGAGACAAAATCATGAATGTCTATGCGA
CTGTGACAATTCAAACAGTGATGATTTTGCACAAACGACGCCACCAGATTCCGAATTGTTAGCTATCAGTGAAGAGATCA
ATGGATCAGTAGTGAACAAAAGTGATACTAATCTCTGGAGAAAATCGGTTCTTCTTCCATGTTCTCGACCTAAGATATTC
AAGAATACTGGTCCTTTCAGCTATAAGAGACTGCTTCCATACTTGATGCAAGCTTCAGATGATGGAACATCATCATCAAG
CCGGTGCTCAAAGTCTTTGAGTCAGAACATCACTAAACCGGTTTCGCAGTCTATGGACAGTGTCTATGATAAAGATTCAA
CCGGAAGCTTCTGTAGAGACACCAGCCCTTTGAAGAGTGTTATTGCATCCACCCCTAACAAAAATGCTGCATTCTCTAGG
GGTAAGCTATTTAAGACACCAGGTTCTGTTAATTACAGAAGAATGCTTCCATATCTCAAAGATATTCAAGAGGATAATCC
TTATCCTCAAAAGAACACAGAGGAGGTTATTTCATCACCGATGTTAAACTCTGAGTCTGATAATGAAGGGACACAGGAAG
TGGTGACATCAAATGTTACTAGAGAATCAGGTACAAGCTCTGATGAAAACGAAGAGCCCCTTCCTTGTGAACGTGTACCT
GTAAATCTAGAACAGTCTGATCCTGACAAGGAACAAGAAACACAGATTAAGCATGTCATCCCAGATACTGAAAATAATTT
GGGCTCTGAGATCCCATTATCATCTCCTCTTGTTGGTTCAAGAAGTTCAAGTGAAGTTAATTCATCTGCATTGCACAACA
CATTTGTAGACAATTTGGTGGGCGAAGAAAACATGAATGGTGCAGAGATAACAGAAGCAAAGATCAGTGCAGAGGAACTA
GAGGCACATAGTTCAGATGCAACAGCTGAACTGGTTGACCCTTCTGTTATATTGGCAACTCCTTCCTCCTTTTCTCCCTC
GAAAGGAATTCTGAAAAGAAGTATGAGAGGATGTAGAGGGATATGCTCTTGTTTGAACTGCTCCTCCTTCCGTCTACACG
CCGAAAGAGCATTTGAATTCTCAAGAAATCAGTTACAAGATACTGAAGTAATGGTTTTGGATCTAGTTGGAGAAATATCT
CATCTCAGGGATTTGTTGGAGAAATATAATTCAGCAGATCACAGTGAACCCTACAAAAGTCAGGCTGGTGAAGCTTCGAA
GAGAGCTTGTGAGGCTGCAGAGCTTGCAAAAAGCCGCCTCCACCAGATGAACGATGACCTTCAAATTCACTACAGAATCC
CCAACGAACAACGAGCAAGAGTGAAATTTGCTCATTATATACACGAGAAGACGATTGTAAAAGCATCCGAACCTAACAAA
TTGATCAGTAGATCACCCTGA