Details for Arabidopsis Locus AT3G23715

Position : Chr3 ( 5`- 8536850 .. 8537273 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23715

Protein [Map View]
MRCVTSFVVLCILMFLVVNNVKVDVKAQRRKPVCKLTGVLNPGKCPTAIHDASNLCSRKLASPNMTFKRCDCQNTEWRGK
DHYQCTCYIKLPCNQ*

DNA
ATGAGGTGTGTTACCTCGTTTGTAGTTTTGTGTATTCTCATGTTCCTTGTGGTAAACAATGTTAAAGTAGATGTGAAAGC
ACAACGAAGGAAACCTGTTTGTAAATTGACTGGTGTCCTAAACCCTGGAAAATGTCCCACAGCTATACATGATGCAAGCA
ACTTGTGTAGTCGCAAATTGGCTTCACCTAATATGACATTTAAGCGTTGCGACTGTCAAAACACTGAATGGCGAGGGAAA
GACCACTATCAATGCACATGTTATATAAAACTCCCTTGCAACCAATAG