Details for Arabidopsis Locus AT3G23650

Position : Chr3 ( 5`- 8510689 .. 8511196 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23650

Protein [Map View]
MRAKISDFGCIKLVLEGVDSVETLTMVGTFNYILIHIMLVSFKSVKKSRCICFRGDSNGVDHMKKVNDETLSVEEQNLVM
WLCPKIKDSTFLNLVDGTIATDEETIKSIKKIAKLAEYCTSQEVESRPLRASRT*

DNA
ATGAGAGCGAAGATTTCTGATTTTGGTTGTATAAAGCTCGTACTCGAGGGAGTCGACTCAGTTGAGACATTAACAATGGT
GGGAACCTTCAACTATATATTGATCCATATTATGTTGGTAAGTTTTAAGAGTGTCAAAAAAAGCAGATGTATATGCTTTC
GGGGTGATTCTAATGGAGTTGATCACATGAAGAAAGTGAATGATGAGACTTTGAGTGTTGAGGAACAAAATCTGGTCATG
TGGTTATGTCCGAAGATTAAAGATTCAACATTCTTGAACTTGGTTGATGGCACCATAGCAACAGACGAAGAAACCATTAA
AAGCATTAAGAAGATTGCGAAATTGGCTGAATATTGCACTTCTCAAGAAGTTGAAAGTAGACCATTGAGAGCATCAAGAA
CATAA