Details for Arabidopsis Locus AT3G23637

Position : Chr3 ( 5`- 8499727 .. 8499888 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23637

Protein [Map View]
MLVSNISGKLMSQLMEKMKERLEKMKRTVRQQRAKLHIIRICITMLLSSDDYS*

DNA
ATGTTGGTATCCAACATATCTGGAAAATTGATGAGTCAGTTGATGGAAAAGATGAAAGAGAGGTTGGAGAAGATGAAGAG
GACAGTGAGGCAACAAAGAGCAAAGCTTCATATCATCAGAATTTGCATCACTATGCTTCTTTCTTCCGATGATTACTCAT
AA