Details for Arabidopsis Locus AT3G23635

Position : Chr3 ( 5`- 8497941 .. 8498072 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23635

Protein [Map View]
MSERRVGSYRKSTLRCWDWCKEQRTRAYIIWRCLIFLLRWDDY*

DNA
ATGTCGGAGAGACGAGTTGGGTCCTATCGTAAATCGACACTCAGGTGTTGGGATTGGTGTAAGGAGCAGAGAACGCGTGC
TTATATCATCTGGAGGTGTTTGATTTTCTTGTTACGGTGGGATGACTATTGA