Details for Arabidopsis Locus AT3G23630

Position : Chr3 ( 5`- 8488695 .. 8490210 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23630

Protein [Map View]
MKFSISSLKQVQPILCFKNKLSKVNVNSFLHPKEKVIFVMGATGSGKSRLAIDLATRFQGEIINSDKIQLYKGLDVLTNK
VTPKECRGVPHHLLGVFDSEAGNLTATQYSRLASQAISKLSANNKLPIVAGGSNSYIEALVNHSSGFLLNNYDCCFIWVD
VSLPVLNSFVSKRVDRMMEAGLLEEVREVFNPKANYSVGIRRAIGVPELHEYLRNESLVDRATKSKMLDVAVKNIKKNTE
ILACRQLKKIQRLHKKWKMSMHRVDATEVFLKRNVEEQDEAWENLVARPSERIVDKFYNNNNQLKNDDVEHCLAASYGGG
SGSRAHNMI*

DNA
ATGAAGTTCTCAATCTCATCACTGAAGCAGGTACAACCAATCTTGTGCTTCAAGAACAAGCTATCTAAGGTCAACGTCAA
CTCTTTTCTCCATCCCAAAGAAAAAGTCATCTTTGTGATGGGAGCTACCGGATCGGGTAAGTCTCGTCTCGCCATCGACC
TAGCAACTCGTTTTCAAGGAGAGATCATAAACTCCGACAAGATTCAACTTTACAAGGGCCTAGACGTCCTAACAAACAAA
GTCACCCCTAAAGAATGCCGAGGCGTGCCTCACCACTTGCTTGGAGTATTCGACTCCGAAGCCGGAAACCTAACGGCCAC
CCAGTATAGCCGCCTTGCGTCACAAGCAATCTCGAAACTCTCAGCGAACAACAAGCTTCCCATAGTAGCCGGTGGATCAA
ACTCTTACATCGAAGCACTTGTTAATCATTCCTCGGGGTTTTTATTAAACAACTACGATTGTTGTTTCATTTGGGTCGAC
GTTTCCTTACCCGTACTTAACTCCTTTGTCTCAAAACGTGTCGACCGCATGATGGAAGCAGGATTACTCGAAGAAGTAAG
AGAAGTGTTCAATCCAAAAGCGAATTACTCCGTAGGGATACGACGAGCTATCGGAGTCCCCGAGCTCCATGAATATTTAC
GTAACGAATCTCTAGTGGACCGTGCCACAAAAAGTAAAATGCTTGACGTAGCCGTTAAAAATATCAAAAAGAACACTGAG
ATTTTAGCTTGTCGACAGTTAAAAAAGATTCAACGGCTTCACAAGAAGTGGAAGATGTCTATGCATCGTGTTGACGCCAC
TGAGGTGTTCTTGAAACGCAACGTAGAAGAACAAGACGAGGCTTGGGAGAATCTTGTAGCGAGACCAAGCGAGAGAATCG
TCGATAAGTTTTATAATAATAATAACCAACTGAAAAATGATGATGTTGAGCACTGTTTGGCGGCATCTTACGGCGGAGGA
AGTGGAAGTAGAGCCCACAATATGATATGA