Details for Arabidopsis Locus AT3G23620

Position : Chr3 ( 5`- 8480025 .. 8482157 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23620

Protein [Map View]
MMEIRTPKTGKAKRVLESRAPKLVETGKKTLILHGTKTSATLSSVMTELYRLKKGGAIRYSRRNENIRPFESGGETSLEF
FSQKTDCSIFVYGSHTKKRPDNLVLGRMYDHQVYDLIEVGIENFKSLRAFSYDKKFAPHEGTKPFICFIGEGFENVSELK
HLKEVLTDLFRGEVVDNLNLTGLDRAYVCSAISPTKVFLTHCALKLKKSGSIVPRMELVEVGPSMDLVIRRNRLPNDSLM
KEAMRTSKDKPKKKEKNVDQDAVLGKTGKIYMPDQKLKEMKLFDKSKGSKRERKDAKLKHKEETVAKKMKVSSE*

DNA
ATGATGGAAATACGAACTCCGAAGACTGGCAAAGCCAAGCGTGTTCTCGAAAGCCGAGCTCCTAAGTTGGTTGAAACTGG
GAAGAAGACGTTGATACTTCATGGAACAAAGACGAGTGCTACACTTAGCTCTGTAATGACGGAACTCTACCGTTTGAAGA
AGGGAGGTGCCATCAGATATTCAAGGAGGAATGAGAATATTAGGCCTTTCGAGAGTGGAGGTGAAACTTCATTAGAGTTC
TTCTCTCAGAAAACAGATTGTAGCATTTTTGTGTATGGTTCTCACACGAAGAAACGACCTGACAATCTTGTACTTGGGAG
AATGTATGATCACCAAGTCTATGATCTTATAGAAGTTGGGATTGAGAACTTTAAATCCTTGCGGGCGTTTTCGTATGACA
AGAAATTCGCACCTCATGAAGGAACAAAGCCTTTCATTTGCTTTATTGGTGAAGGTTTTGAGAATGTATCAGAGCTTAAG
CATCTCAAAGAAGTCCTCACTGATCTTTTTCGTGGCGAGGTTGTGGATAATCTAAATCTTACTGGTTTAGACCGCGCTTA
CGTATGTTCAGCTATATCCCCAACAAAGGTTTTCCTTACTCATTGCGCATTGAAGCTTAAAAAGTCAGGATCCATTGTTC
CGAGAATGGAGCTTGTTGAAGTCGGTCCATCCATGGACTTGGTTATCAGGCGTAATCGTCTTCCTAACGATAGCTTAATG
AAAGAAGCAATGAGAACATCCAAGGATAAGCCTAAGAAGAAGGAGAAAAACGTTGATCAAGATGCAGTACTAGGGAAGAC
TGGGAAGATTTATATGCCTGATCAGAAGCTGAAAGAAATGAAACTGTTCGATAAATCTAAGGGATCGAAGAGAGAGCGGA
AAGACGCTAAGCTTAAGCATAAGGAAGAGACTGTTGCCAAAAAGATGAAGGTGTCTTCTGAGTGA