Details for Arabidopsis Locus AT3G23580

Position : Chr3 ( 5`- 8460045 .. 8462815 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23580

Protein [Map View]
MGSLKEGQGRDMEEGESEEPLLMAQNQRFTMFPIRYKSIWEMYKKAEASFWTAEEVDLSTDVQQWEALTDSEKHFISHIL
AFFAASDGIVLENLAARFLNDVQVPEARAFYGFQIAMENIHSEMYSLLLETFIKDSKEKDRLFNAIETIPCISKKAKWCL
DWIQSPMSFAVRLVAFACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLQKQLPLEKVYQI
VHEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERTYKAENPFDWMEFISLQGKTNFFEKRVGEYQKA
SVMSNLQNGNQNYEFTTEEDF*

DNA
ATGGGTTCGCTTAAGGAAGGTCAAGGAAGAGACATGGAAGAAGGTGAATCAGAAGAGCCGCTTTTGATGGCTCAGAACCA
GAGATTCACTATGTTCCCCATTAGGTACAAATCTATTTGGGAGATGTATAAGAAGGCTGAAGCCAGTTTCTGGACTGCTG
AAGAGGTTGATCTTTCCACTGATGTGCAACAGTGGGAGGCCTTGACGGATTCAGAGAAACACTTTATCAGCCATATTCTG
GCGTTTTTCGCAGCGTCAGATGGTATTGTTTTGGAGAATTTGGCTGCTAGATTCTTGAATGATGTCCAAGTTCCAGAGGC
TCGTGCTTTCTATGGGTTTCAAATAGCCATGGAGAACATTCATTCAGAGATGTACAGCTTACTTCTGGAGACATTCATAA
AGGACTCGAAGGAGAAGGATAGATTGTTCAATGCTATCGAGACCATTCCTTGTATATCCAAGAAGGCAAAATGGTGTTTA
GATTGGATTCAAAGTCCTATGTCGTTTGCTGTGAGGCTGGTCGCTTTTGCATGTGTCGAAGGAATCTTCTTCTCAGGAAG
CTTCTGTGCCATCTTCTGGCTAAAGAAGAGGGGTCTTATGCCGGGTTTGACCTTCTCAAACGAGCTTATATCGAGAGACG
AGGGGCTCCACTGTGACTTTGCGTGTCTCTTGTACAGTTTGCTGCAGAAGCAGCTTCCATTGGAGAAAGTTTATCAAATT
GTTCACGAGGCAGTGGAAATTGAGACAGAGTTTGTCTGCAAGGCTCTTCCATGTGATCTGATCGGAATGAACTCAAACCT
CATGAGTCAATACATACAATTTGTCGCTGACCGTCTTCTGGTTACCTTGGGATGTGAAAGGACATACAAAGCAGAAAATC
CATTTGACTGGATGGAGTTCATATCTCTGCAAGGAAAGACAAACTTCTTTGAGAAGAGAGTGGGAGAGTATCAGAAGGCA
TCAGTTATGTCGAACCTCCAAAATGGAAATCAGAACTACGAATTCACGACTGAAGAGGACTTTTGA