Details for Arabidopsis Locus AT3G23550

Position : Chr3 ( 5`- 8448273 .. 8450697 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23550

Protein [Map View]
MADPTSKDDHDGEGGRDKSSTFVQKLIDVEEAKTQIIYSLPMIFTNLFYYCIPLTSVMFASQLGQLELAGATLANSWATV
TGFAFMTGLSGALETLCGQGFGAKSYRMLGIHLQSSCIVSLVFTILITILWFFTESVFLLLRQDPSISKQAALYMKYLAP
GLLAYGFLQNILRFCQTQCIVTPLVLFSFLPLVINIGTTYALVHLAGLGFIGAPIATSISLWIAFVSLGFYVICSDKFKE
TWTGFSMESFHHVVLNLTLSIPSAAMVCLEYWAFEILVFLAGLMRNPEITTSLVAICVNTESISYMLTCGLSAATSTRVS
NELGAGNVKGAKKATSVSVKLSLVLALGVVIAILVGHDAWVGLFSNSHVIKEGFASLRFFLAASITLDSIQGVLSGVARG
CGWQRLATVINLGTFYLIGMPISVLCGFKLKLHAKGLWIGLICGMFCQSASLLLMTIFRKWTKLTAATV*

DNA
ATGGCTGATCCCACGTCCAAAGATGACCATGATGGTGAAGGAGGAAGAGACAAATCATCAACTTTTGTTCAAAAACTTAT
TGACGTTGAAGAAGCAAAGACTCAAATCATTTACTCTCTACCAATGATATTCACCAATCTTTTCTATTATTGTATCCCTT
TAACCTCTGTGATGTTCGCTTCTCAACTCGGCCAACTCGAGCTCGCCGGTGCTACCCTAGCCAATTCTTGGGCTACCGTC
ACCGGTTTTGCCTTCATGACAGGGTTAAGTGGAGCACTTGAGACATTGTGTGGACAAGGCTTTGGTGCAAAAAGCTATAG
AATGTTGGGGATTCATCTACAATCATCTTGCATTGTTTCATTAGTCTTCACCATTCTCATCACCATCTTATGGTTCTTCA
CGGAATCGGTTTTCTTACTTCTTAGACAAGATCCTAGCATCTCAAAACAAGCTGCACTCTACATGAAGTACCTAGCTCCC
GGTTTACTCGCTTACGGGTTCTTACAAAACATTTTGAGATTTTGCCAAACACAATGCATCGTTACTCCGCTAGTTTTATT
CTCGTTTCTTCCCTTGGTGATTAATATCGGTACTACATATGCTCTGGTGCATTTAGCTGGGCTTGGATTCATCGGTGCTC
CAATAGCTACATCTATTTCATTGTGGATAGCTTTCGTTTCTCTCGGGTTTTATGTGATTTGTTCGGACAAGTTTAAGGAA
ACATGGACCGGATTTTCGATGGAATCATTTCATCATGTAGTACTAAACTTGACATTAAGCATCCCTTCTGCTGCTATGGT
ATGTTTGGAATATTGGGCGTTCGAGATTCTAGTGTTCTTAGCAGGATTGATGCGAAATCCGGAAATCACCACTTCTTTGG
TAGCTATATGCGTCAACACGGAATCAATAAGTTACATGTTAACATGCGGACTTAGTGCAGCTACAAGTACGCGTGTGTCC
AACGAACTTGGAGCAGGAAATGTAAAAGGCGCAAAGAAGGCGACTTCGGTCTCCGTTAAGTTGTCTTTAGTTCTAGCTCT
CGGTGTAGTCATTGCTATACTTGTAGGTCATGATGCCTGGGTTGGTTTATTCAGCAATAGCCATGTGATTAAAGAGGGAT
TTGCATCACTAAGGTTTTTCCTTGCTGCATCTATAACACTTGATTCAATCCAAGGTGTTTTATCAGGAGTTGCGAGAGGA
TGCGGATGGCAGCGGTTAGCCACGGTTATAAATTTGGGAACATTCTACTTAATCGGAATGCCTATTTCAGTCCTTTGTGG
TTTCAAGTTGAAGCTTCATGCCAAGGGTTTATGGATCGGTCTGATATGTGGGATGTTTTGCCAGTCCGCATCTCTTTTGC
TTATGACAATTTTCCGGAAGTGGACAAAGCTGACTGCTGCCACTGTCTGA