Details for Arabidopsis Locus AT3G23540

Position : Chr3 ( 5`- 8443445 .. 8448070 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23540

Protein [Map View]
MDQLVNFIIRPPRAEYDPEHDLLEKKFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERPEGKPLPCVIYCHGNSGCRAD
GSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEFLRQDGNISLIGLWGRSMGAVTSLMYGVEDPSIA
GMILDSPFSDLVDLMMELVDTYKFRLPKFTVKFAIQFMRRAIQKKAKFDIMELNTIKVAKASFVPVLFGHALDDDFIRPH
HSDRIYEAYVGDKNIIKFPGDHNSPRPPFYFDSINIFFHNVLQPPEVVGPTFYDPLDDYFANGSWGTMNDTNIPQSSVQK
SLAAGSISEAINEVRKKRPMSRTDVPSNVTLTSNGSPSETKEKENPDGRGSSSSPDMISFDLSDGNQYPPHLRMALDDDQ
YVEYQMEDMADFPSNAEEEERMLMKAVMESLKDLEVQSQQKKEPPETRIHGGSAFLNAVQCISSREESTSTRANQSETDS
ASSPVTRSQDQLPSSSESNPPSETSSSLARTVTSSVPGSLSQKESETGDVPGTKATVTVERSSSAPGKVLDGLIRRWDLN
FFKNNK*

DNA
ATGGATCAGCTCGTTAACTTCATCATTCGACCTCCAAGAGCTGAGTATGACCCGGAACATGATCTCTTGGAAAAGAAGTT
TATGATGAAAGGTAGATGGTATCAGAGAAAAGATTTAGAGGTTAAAAACAGTAGGGGAGATGTTCTCCAGTGTAGTCATT
ATATGCCAGTTGAACGCCCTGAAGGAAAGCCTTTACCCTGTGTAATATACTGCCACGGAAACAGTGGATGTAGAGCGGAT
GGTAGTGAAGCCGCAATTGTGTTGCTGCCTTCGAACATCACAGTTTTTACCCTTGACTTTTCGGGATCGGGTCTCTCAGG
CGGGGAACATGTCACCTTAGGCTGGAACGAAAAGGATGATCTGAAGGCTGTGGTTGAGTTTTTGCGGCAGGATGGAAACA
TATCCTTGATTGGGCTATGGGGGCGGTCAATGGGTGCTGTTACTAGCTTGATGTATGGAGTCGAGGATCCTTCGATTGCA
GGAATGATTCTAGACAGCCCCTTCTCCGATTTAGTTGATCTGATGATGGAACTTGTTGATACATATAAGTTTCGTCTGCC
AAAGTTTACTGTAAAATTTGCTATACAGTTTATGCGGAGAGCTATTCAGAAAAAAGCAAAGTTTGATATAATGGAATTGA
ACACCATTAAGGTGGCAAAGGCTAGTTTTGTTCCGGTTTTATTTGGACATGCCTTAGATGATGACTTTATCCGCCCTCAT
CATTCAGATCGTATATATGAAGCTTACGTAGGTGACAAAAATATCATCAAATTTCCGGGAGACCACAACTCCCCAAGGCC
TCCATTCTATTTTGATTCGATCAATATCTTTTTCCATAACGTTCTTCAACCCCCAGAGGTGGTGGGGCCGACATTTTATG
ACCCATTGGATGATTACTTTGCAAATGGCAGTTGGGGAACTATGAATGACACAAATATTCCACAATCCTCTGTACAGAAA
AGTTTAGCCGCAGGTAGCATCTCTGAGGCAATTAATGAAGTCCGCAAGAAACGACCCATGAGTCGCACAGATGTTCCTTC
AAATGTCACACTCACATCTAACGGTTCTCCATCAGAAACTAAGGAAAAAGAGAATCCTGATGGCCGTGGCAGTTCATCGT
CTCCTGATATGATAAGCTTTGATTTGTCAGACGGCAATCAATACCCTCCTCACCTTAGGATGGCTTTAGATGATGATCAA
TATGTTGAGTATCAGATGGAGGACATGGCTGATTTCCCATCTAATGCAGAGGAAGAAGAAAGAATGCTTATGAAAGCGGT
GATGGAATCGTTGAAAGACTTGGAAGTGCAAAGTCAACAGAAAAAAGAACCTCCTGAGACGAGAATTCATGGCGGCTCTG
CTTTTTTAAATGCAGTTCAATGCATTTCATCCAGGGAAGAATCAACTTCAACTCGAGCAAATCAATCAGAGACTGATTCT
GCTTCCAGTCCAGTAACACGTAGCCAGGATCAACTACCGTCATCTTCTGAGTCCAATCCTCCTAGTGAGACCTCGAGTTC
TCTGGCGAGAACCGTAACCTCTTCTGTTCCCGGCTCTTTAAGCCAGAAGGAAAGCGAGACTGGTGACGTGCCAGGTACAA
AGGCCACCGTGACAGTGGAACGTAGTAGTAGTGCACCGGGGAAAGTCTTAGACGGGTTAATACGCAGGTGGGATCTTAAC
TTTTTCAAAAACAACAAATAA