Details for Arabidopsis Locus AT3G23490

Position : Chr3 ( 5`- 8423011 .. 8424652 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23490

Protein [Map View]
MEAAKKQSVTNQLLAVKSASGKTFSQLAAETGLTNVYVAQLLRRQAQLKPDTVPKLKEALPALTDELIGDMMSPPWRSYD
PNLIQEPTIYRLNEAVMHFGESIKEIINEDFGDGIMSAIDFYCSVDKIKGVDGNNRVVVTLDGKYLSHSEQRTENMVSRL
NLKGGTSE*

DNA
ATGGAAGCGGCGAAGAAACAGAGTGTTACAAATCAGCTTCTCGCCGTGAAATCAGCTTCCGGCAAGACTTTTAGCCAGTT
AGCCGCGGAGACAGGTCTAACCAACGTATACGTAGCTCAGCTTCTCCGTCGTCAAGCTCAGCTCAAACCGGACACAGTCC
CAAAGCTTAAGGAAGCTTTACCAGCTCTGACCGATGAACTAATCGGAGATATGATGTCTCCTCCGTGGAGATCCTATGAT
CCTAATCTCATCCAAGAACCCACTATCTACAGGTTGAATGAAGCAGTGATGCATTTTGGTGAGAGTATAAAGGAGATTAT
CAATGAAGATTTTGGAGATGGCATCATGTCGGCGATAGATTTCTATTGCTCTGTCGACAAAATCAAAGGAGTGGATGGTA
ACAATCGCGTGGTTGTGACGCTTGATGGAAAGTATCTTTCGCATTCCGAACAGAGGACGGAGAATATGGTCTCAAGGCTA
AATCTCAAGGGAGGTACAAGCGAATGA