Details for Arabidopsis Locus AT3G23460

Position : Chr3 ( 5`- 8412319 .. 8414319 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23460

Protein [Map View]
MVTPMSNRKHMVMSLIEKAARFFFTRFLTHFISTGCVTIFEGGNMVTFEGKDSRCHLKSELEIHSPQFYWKVMTQVDLGL
ADAYINGDFSFVNKETGLLNLIMILIASKELNSNLAEKRGRWTPIFLTTGLSSAKHFLKHLYRQNNLTQARRNISRHYDL
SNELFTIFLDDTMSYSSGVFKSDDEELKIAQMRKIYLLIEKTAYLSCSIENVENIGIHYYQTLRLWRKNFFERQKQITDL
GFDDRFVRTCEYYFDYCAAGFKTRTVGDYQIVFSRPGNVIALGDDSFYSSPLTQKKQLQMNHFDS*

DNA
ATGGTGACTCCTATGAGCAACCGAAAACACATGGTCATGTCTCTAATCGAAAAAGCGGCTCGGTTTTTCTTTACTAGATT
CTTGACACATTTCATATCAACGGGTTGTGTAACAATTTTTGAAGGAGGAAACATGGTCACTTTCGAAGGAAAGGATTCGA
GATGTCACTTGAAATCTGAACTAGAGATTCACAGTCCTCAGTTTTACTGGAAGGTTATGACACAGGTTGATTTAGGACTT
GCTGATGCTTATATCAATGGAGATTTTTCATTTGTCAATAAGGAAACAGGACTTTTGAATCTGATCATGATTCTCATTGC
TAGCAAAGAATTGAACTCAAATCTTGCTGAGAAAAGGGGTCGGTGGACACCAATTTTTTTGACTACTGGTTTATCATCTG
CAAAGCATTTCTTAAAGCATCTCTATAGGCAGAACAATTTAACTCAAGCTCGAAGGAACATTTCGCGACACTATGACCTT
AGTAATGAACTTTTTACTATATTCTTGGATGATACCATGTCTTATTCCTCTGGGGTATTCAAGTCGGATGATGAAGAGTT
GAAGATTGCACAAATGAGAAAGATATATCTTCTAATTGAGAAGACGGCATATTTGTCTTGCAGCATTGAAAACGTTGAGA
ACATTGGGATTCATTACTACCAAACGTTAAGATTGTGGAGGAAGAATTTCTTCGAGAGACAAAAACAAATCACGGATCTT
GGATTCGACGATAGATTCGTAAGGACATGTGAATATTATTTCGACTATTGTGCAGCTGGCTTCAAGACTCGTACCGTAGG
AGACTACCAGATAGTTTTCTCACGTCCAGGGAACGTAATTGCACTCGGTGATGATTCATTCTACAGCTCTCCTTTAACTC
AGAAAAAACAACTTCAAATGAATCATTTTGATTCTTAA