Details for Arabidopsis Locus AT3G23440

Position : Chr3 ( 5`- 8404358 .. 8404684 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23440

Protein [Map View]
MNQNHHAHEGASRKRKDTESDLREAATPNWLLAGYMAHEYLTCGTMLGRKLYSGWAEVGPLVSPSPLQSREVKKARQSYS
EVASVFKTDGNHVPGVVNPTQLAKWIQM*

DNA
ATGAATCAAAACCATCACGCGCATGAGGGCGCGTCGAGAAAACGTAAAGACACGGAGAGTGATCTAAGAGAAGCCGCCAC
ACCGAACTGGTTATTGGCTGGCTACATGGCACACGAGTACCTCACGTGCGGTACTATGTTGGGCCGGAAGCTGTATTCAG
GATGGGCCGAAGTTGGGCCGCTAGTCTCGCCATCACCATTACAGAGCAGAGAAGTGAAAAAGGCTCGCCAGAGTTACTCT
GAAGTGGCGAGTGTGTTCAAAACAGATGGAAACCATGTCCCTGGTGTGGTTAACCCGACCCAGCTTGCTAAATGGATCCA
GATGTGA