Details for Arabidopsis Locus AT3G23420

Position : Chr3 ( 5`- 8386273 .. 8387324 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23420

Protein [Map View]
MAEEVLSRVPMTSLRRLRFTCKKWNTLSRCRSFAKKHLVCQAKVAAKKREYKVVMMMDFRVYLMRINLQNNVELCIKRER
ELLFPDASDQIYVRHVFHCDGLLLCIMKDNPRLVVCNPYSGQTRWIETTNNPQRLDAYSYALGYNSSTKSHKILSFGMMF
DYVSSTSAEFKIYDFNSDSWRGDIWAAVCLRRPLSGIFKSSLLLSNVRDEQLAVLFQRMDTLQMEIWVTTKIEPNTVSWS
SKFFLSVDMRELTGRYSMFSFSDASFFIDEEKKVAVLTSLERMDP*

DNA
ATGGCGGAGGAGGTGCTTTCTAGGGTTCCGATGACATCTCTAAGAAGACTCCGATTTACTTGCAAAAAGTGGAACACTTT
ATCTAGATGTAGGAGCTTTGCAAAGAAGCACCTTGTTTGTCAAGCAAAAGTAGCTGCAAAGAAAAGAGAGTATAAGGTGG
TCATGATGATGGATTTTAGGGTTTATTTGATGCGCATAAATCTTCAGAACAACGTTGAATTGTGTATAAAGCGTGAACGT
GAACTTCTTTTCCCCGACGCTTCAGATCAAATTTACGTCCGTCACGTCTTTCACTGCGACGGTTTATTGTTATGCATCAT
GAAAGACAACCCTAGGCTTGTGGTTTGTAACCCGTATAGTGGACAAACCCGGTGGATCGAGACTACAAATAATCCTCAGA
GATTAGATGCATATTCGTATGCTCTCGGATACAATAGCAGTACCAAATCCCACAAAATCTTGAGTTTTGGTATGATGTTT
GATTATGTCTCCTCCACTTCTGCTGAGTTCAAAATCTACGACTTTAACTCTGACTCATGGAGGGGAGACATTTGGGCCGC
GGTTTGCCTTCGCCGCCCTTTGAGTGGTATCTTCAAGAGTTCTCTGTTATTATCTAATGTTAGAGATGAGCAGCTTGCGG
TGTTATTTCAGCGTATGGATACATTACAGATGGAGATCTGGGTTACAACTAAGATTGAGCCCAACACGGTGTCATGGAGC
AGCAAGTTCTTCTTATCAGTGGATATGAGAGAACTCACCGGCCGTTACTCTATGTTTTCGTTTAGTGATGCAAGTTTCTT
CATTGATGAGGAGAAGAAAGTTGCAGTGCTTACATCGTTGGAGAGGATGGATCCTTGA