Details for Arabidopsis Locus AT3G23370

Position : Chr3 ( 5`- 8357585 .. 8360865 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23370

Protein [Map View]
MAIARLLSPKSTPQFNNRGFVILTRRWLSSSLEDGRKCERLSDSEASTNKDIGQKVVHWYSLGGLISNLKQKIMGNVILM
DKSSGEDSVLPKSPMVSSSDVAVTKVVTLKNVAESENCIHSSVKEEIGSEDASQSVAADNKICITSSIKEESFVSEMGSQ
DASQSVAVENKNCISSSIKEESSVSEMGSQDASQSVAGIEACGKRESITVSNDRLGNINRLDGLESGQGKVLRSIRTERV
DPSEEQSSKDVTLGFLTEEVSESQTSSRKNMGKLQPAKGLFDKVKPPQNSLSKLFVNSDPYKEVKHPLRFETLSNSNSSM
STGESCSDAGDQHSLFGKMLSDPVQEIKSIPNENDEHRLSDAPQNLSSLTSVLLRDWIDEQRSEDLAAIRERKSIFSLES
SRNTVAPMAVGTMKKLMDSLNFPTDNGTDAEANSLNSNSREEKWISEGNSAMQNSDRFCAIEEEEPQGETFVMETQSLCS
QDTLDATTVNPKVTKKSFLALSAGEHSPNKVLLRFLPESSMKKHIVKAFSSQFGAVLHVQEIPSIEGCIYKDALLTFETN
TAVKKALKKGHVTVMNYNTVVEATSQEDMVERICIPDLIGDPDVPVALVKEPARTVKIHPLTHDFSSNQIKEALKFCRSN
ISKFTLGSSRTDAFVEFETEDGKERALAEHSISICNTQLFISRIDIPRTIVARISNLSKSAMRDVRALCVPYGQIRGVYI
RGTGVADVFFDISEWPNMLAILNSMNGMEIDGKKLVVRPATTVIPPEILRVLWKDPREKRYVKSVIQNLVREIEQPLDAT
RCHTLITELLL*

DNA
ATGGCCATTGCTCGTTTACTTTCACCCAAATCAACTCCTCAATTCAACAATAGAGGTTTTGTAATTTTGACGAGGAGGTG
GTTATCTTCTTCTCTTGAGGATGGTCGGAAATGTGAGAGATTGTCAGATTCTGAAGCTTCCACGAACAAAGATATTGGAC
AAAAGGTAGTGCATTGGTATTCTTTGGGAGGTTTAATTAGTAATCTAAAGCAAAAGATTATGGGAAACGTAATTTTGATG
GACAAAAGTTCTGGTGAAGACTCGGTTTTGCCAAAATCGCCAATGGTTTCCTCATCAGATGTGGCTGTTACGAAAGTGGT
GACCTTGAAGAACGTTGCAGAAAGCGAAAACTGTATCCATTCGAGTGTAAAAGAAGAAATTGGATCTGAAGATGCATCTC
AAAGTGTTGCTGCGGATAATAAGATCTGTATCACTTCGAGTATAAAAGAAGAATCTTTTGTCTCGGAAATGGGATCTCAA
GATGCATCTCAAAGTGTTGCTGTAGAAAACAAGAACTGTATCTCTTCTAGTATAAAAGAAGAATCTTCAGTCTCTGAAAT
GGGATCTCAAGATGCATCTCAAAGTGTTGCAGGAATTGAGGCTTGTGGGAAGAGAGAAAGCATAACTGTAAGTAATGACA
GATTAGGTAATATTAATAGGTTAGATGGCTTGGAGTCTGGGCAGGGGAAGGTGTTGAGATCAATACGCACTGAAAGGGTG
GATCCTTCTGAGGAACAAAGTTCTAAAGATGTCACTTTAGGTTTCTTGACTGAAGAAGTATCGGAAAGTCAGACATCATC
TAGGAAAAATATGGGGAAGTTGCAGCCTGCGAAAGGGCTATTCGATAAAGTGAAGCCACCTCAAAATAGTCTCTCGAAGT
TGTTTGTAAACTCGGATCCATATAAAGAGGTTAAGCATCCTCTGAGATTTGAGACTTTGAGTAACAGTAATTCCAGTATG
TCTACTGGAGAATCCTGTAGTGATGCAGGTGATCAACACAGCCTATTTGGTAAGATGCTGTCTGATCCTGTCCAGGAAAT
TAAAAGTATCCCCAACGAAAATGATGAGCACAGGTTGTCGGATGCTCCTCAAAATCTCAGCTCTTTGACATCCGTTCTAT
TAAGGGATTGGATTGATGAACAGAGGAGTGAAGACCTGGCTGCTATTAGAGAAAGGAAAAGTATATTTTCGCTTGAAAGT
TCTAGAAACACTGTTGCACCTATGGCAGTGGGTACTATGAAGAAGTTGATGGACTCCCTTAACTTTCCAACTGACAATGG
CACAGATGCAGAAGCCAACTCGTTGAATTCTAATAGTAGAGAAGAGAAATGGATATCCGAAGGCAATTCTGCAATGCAAA
ACAGTGATCGTTTTTGTGCGATAGAGGAAGAAGAACCCCAAGGGGAAACTTTTGTAATGGAAACCCAATCATTGTGCAGT
CAGGACACTTTGGACGCTACCACCGTGAATCCTAAGGTAACAAAAAAGAGTTTCTTGGCATTATCTGCTGGAGAACACTC
TCCTAACAAAGTACTGCTAAGGTTTTTGCCAGAATCATCTATGAAGAAACACATTGTTAAAGCGTTTTCTTCTCAGTTTG
GAGCCGTTTTGCATGTACAAGAAATTCCCTCTATTGAAGGGTGCATTTACAAAGATGCTCTCTTAACTTTTGAGACTAAC
ACTGCAGTCAAGAAAGCTCTCAAGAAAGGCCATGTGACGGTGATGAATTACAATACAGTTGTCGAGGCAACTTCTCAGGA
AGACATGGTAGAAAGGATTTGCATTCCGGATCTCATTGGCGATCCAGATGTGCCTGTTGCATTGGTGAAGGAACCAGCCC
GAACAGTTAAGATTCATCCACTGACGCACGATTTTAGTTCAAATCAGATCAAAGAAGCGCTAAAGTTCTGTAGGAGCAAC
ATATCTAAGTTTACCTTGGGTTCATCGAGAACAGATGCTTTCGTGGAGTTTGAGACGGAAGACGGCAAAGAGAGAGCACT
TGCGGAGCATTCAATCAGCATATGCAACACACAATTGTTTATCTCGAGGATTGATATACCGAGGACAATCGTGGCAAGGA
TTTCAAACTTGTCGAAATCAGCAATGAGAGATGTACGAGCATTGTGTGTACCTTATGGACAGATCAGAGGGGTGTATATC
AGGGGAACTGGTGTTGCGGATGTGTTTTTCGATATCTCTGAGTGGCCAAACATGCTCGCCATTCTCAACAGCATGAATGG
TATGGAGATAGATGGTAAGAAGTTGGTGGTTCGACCTGCAACAACAGTAATACCTCCTGAAATATTGAGGGTTTTGTGGA
AAGATCCTCGAGAAAAGAGATATGTGAAAAGTGTAATTCAGAATCTGGTGAGAGAGATTGAGCAGCCTTTAGATGCAACT
CGTTGCCACACACTTATAACAGAATTACTACTATAG