Details for Arabidopsis Locus AT3G23360

Position : Chr3 ( 5`- 8355257 .. 8356381 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23360

Protein [Map View]
MGFLDLPFMLKAFRFRRLVVEDGKRRKKKKPLWLTPVSHGYYTVDRLSYADNSSNDDSVFVQREQQSDELEIWLFGVSNA
GTGKEIVKYMQNHLFDKLPNELGIMRKCKETMRRAYVEEERTGGSAASVMVVNGEKLAIASIGDHRVVVCKDGEAHQIRD
RKASTKHWSQFIFPVCNQGEEEDESDPRNSELVVITEKINSDTEFIIIGSPGIWEVMKSQEAINLIRHIEDPKEAAKCLA
KEALNRISKSSISCVVIRFG*

DNA
ATGGGCTTCTTAGATCTCCCTTTCATGCTCAAGGCGTTCCGGTTTAGAAGACTTGTAGTTGAAGATGGGAAGAGAAGGAA
GAAGAAGAAACCATTATGGTTAACTCCGGTTTCTCATGGATACTATACGGTTGACCGGTTAAGCTATGCCGACAATTCAT
CGAATGATGATTCGGTTTTTGTTCAGAGAGAGCAACAAAGTGATGAGCTTGAGATTTGGTTATTTGGAGTCTCAAATGCT
GGAACAGGGAAAGAGATTGTCAAATATATGCAAAACCATCTATTTGATAAGCTCCCCAATGAGCTCGGGATTATGAGAAA
GTGTAAAGAGACTATGAGAAGAGCGTACGTTGAGGAAGAGAGAACCGGTGGCTCAGCCGCTTCGGTTATGGTGGTGAACG
GAGAGAAGCTAGCTATAGCGAGTATTGGGGACCATAGAGTAGTGGTTTGCAAAGATGGTGAGGCTCATCAAATCAGAGAT
AGGAAAGCCTCAACAAAACATTGGTCACAATTTATTTTCCCTGTTTGTAATCAAGGAGAAGAAGAAGATGAATCAGATCC
AAGAAATTCAGAGCTTGTAGTGATTACAGAAAAGATTAATTCAGATACAGAATTTATCATTATCGGTAGCCCCGGGATTT
GGGAGGTGATGAAGAGTCAAGAAGCGATTAACCTAATAAGACACATAGAGGATCCTAAAGAAGCTGCAAAATGTTTAGCT
AAAGAAGCTTTAAACAGGATTAGCAAAAGCAGCATTTCTTGCGTTGTAATTCGGTTTGGCTAA