Details for Arabidopsis Locus AT3G23325

Position : Chr3 ( 5`- 8345771 .. 8347062 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23325

Protein [Map View]
MQASDRFNINSQLEHLQAKYVGTGHADLSRFEWTVNIQRDSYASYIGHYPMLSYFAIAENESIGRERYNFMQKMLLPCGL
PPEREDE*

DNA
ATGCAGGCAAGTGATAGGTTTAACATAAATTCTCAGCTTGAGCATCTTCAAGCTAAGTATGTTGGTACAGGTCATGCAGA
TTTGAGCAGATTTGAATGGACTGTGAACATTCAGCGTGATAGTTATGCTTCATACATTGGTCACTACCCGATGCTTTCTT
ACTTTGCAATAGCTGAGAACGAATCTATTGGTCGAGAACGTTACAACTTCATGCAGAAAATGCTCTTACCTTGCGGCCTT
CCTCCAGAAAGAGAAGACGAGTAA