Details for Arabidopsis Locus AT3G23255

Position : Chr3 ( 5`- 8311722 .. 8313125 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23255

Protein [Map View]
MVERFFPTKRSSGDENHRRGNLSLLSGPISSGKTSLLFQLALNVASASTTTRVVFICHRKKIESNPPFLSQGIDPSSDVF
NRIQIKYVDDDEGIRKYFAAFHLHHVDDLPSAVIIDDFGDYFSKLNSVMNSRARDMAMVRTLALCHNAIVDANRKALCEL
VLSETNHGDSPRSLFIYKRWIPKIFTIKGHGDGSFLLTSNDTSERSAKYSIALQYLILEQIIDDS*

DNA
ATGGTAGAGAGATTCTTCCCGACGAAGCGGAGCTCCGGCGACGAGAATCACCGTCGGGGAAATCTCTCGCTTCTCTCCGG
TCCAATTTCCTCAGGCAAAACCTCTCTGCTCTTCCAATTAGCTCTCAATGTAGCGAGTGCTTCTACAACCACTCGTGTCG
TCTTCATCTGTCACCGGAAAAAAATCGAATCCAATCCTCCGTTTCTCTCTCAGGGAATCGATCCTTCCTCTGATGTATTC
AATCGAATCCAGATTAAATATGTAGATGATGATGAAGGAATCAGAAAATACTTTGCTGCGTTTCATCTTCATCATGTTGA
TGATTTACCATCTGCAGTTATAATCGATGATTTTGGTGATTACTTTAGCAAATTGAACTCGGTGATGAATTCTCGGGCTA
GAGACATGGCGATGGTTCGGACTCTTGCTCTATGCCACAATGCTATAGTTGATGCTAATAGGAAAGCTTTGTGCGAGCTT
GTCTTATCTGAGACTAACCATGGAGACTCTCCGAGGTCGTTGTTCATCTACAAACGATGGATTCCGAAGATCTTTACTAT
AAAAGGTCATGGTGATGGATCGTTTCTATTGACAAGTAATGATACATCCGAGAGAAGCGCCAAGTATTCGATCGCGCTGC
AATATCTCATCTTGGAGCAGATTATTGATGATAGTTAG