Details for Arabidopsis Locus AT3G23250

Position : Chr3 ( 5`- 8309209 .. 8310826 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23250

Protein [Map View]
MGRAPCCEKMGLKRGPWTPEEDQILVSFILNHGHSNWRALPKQAGLLRCGKSCRLRWMNYLKPDIKRGNFTKEEEDAIIS
LHQILGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLEDYQPAKPKTSNKKKGTKPKSESVITSSNSTRSESELADSSNPS
GESLFSTSPSTSEVSSMTLISHDGYSNEINMDNKPGDISTIDQECVSFETFGADIDESFWKETLYSQDEHNYVSNDLEVA
GLVEIQQEFQNLGSANNEMIFDSEMDFWFDVLARTGGEQDLLAGL*

DNA
ATGGGAAGAGCTCCATGCTGTGAGAAGATGGGGTTGAAGAGAGGACCATGGACACCTGAAGAAGATCAAATCTTGGTCTC
TTTTATCCTCAACCATGGACATAGTAACTGGCGAGCCCTCCCTAAGCAAGCTGGTCTTTTGAGATGTGGAAAAAGCTGTA
GACTTAGGTGGATGAACTATTTAAAGCCTGATATTAAACGTGGCAATTTCACCAAAGAAGAGGAAGATGCTATCATCAGC
TTACACCAAATACTTGGCAATAGATGGTCAGCGATTGCAGCAAAACTGCCTGGAAGAACCGATAACGAGATCAAGAACGT
ATGGCACACTCACTTGAAGAAGAGACTCGAAGATTATCAACCAGCTAAACCTAAGACCAGCAACAAAAAGAAGGGTACTA
AACCAAAATCTGAATCCGTAATAACGAGCTCGAACAGTACTAGAAGCGAATCGGAGCTAGCAGATTCATCAAACCCTTCT
GGAGAAAGCTTATTTTCGACATCGCCTTCGACAAGTGAGGTTTCTTCGATGACACTCATAAGCCACGACGGCTATAGCAA
CGAGATTAATATGGATAACAAACCGGGAGATATCAGTACTATCGATCAAGAATGTGTTTCTTTCGAAACTTTTGGTGCGG
ATATCGATGAAAGCTTCTGGAAAGAGACACTGTATAGCCAAGATGAACACAACTACGTATCGAATGACCTAGAAGTGGCT
GGTTTAGTTGAGATACAACAAGAGTTTCAAAACTTGGGCTCCGCTAATAATGAGATGATTTTTGACAGTGAGATGGACTT
CTGGTTCGATGTATTGGCTAGAACCGGCGGGGAACAAGATCTCTTAGCCGGGCTCTAG