Details for Arabidopsis Locus AT3G23240

Position : Chr3 ( 5`- 8295644 .. 8296604 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23240

Protein [Map View]
MDPFLIQSPFSGFSPEYSIGSSPDSFSSSSSNNYSLPFNENDSEEMFLYGLIEQSTQQTYIDSDSQDLPIKSVSSRKSEK
SYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAILNFSAERVQESLSEIKYTYEDGCSP
VVALKRKHSMRRRMTNKKTKDSDFDHRSVKLDNVVVFEDLGEQYLEELLGSSENSGTW*

DNA
ATGGATCCATTTTTAATTCAGTCCCCATTCTCCGGCTTCTCACCGGAATATTCTATCGGATCTTCTCCAGATTCTTTCTC
ATCCTCTTCTTCTAACAATTACTCTCTTCCCTTCAACGAGAACGACTCAGAGGAAATGTTTCTCTACGGTCTAATCGAGC
AGTCCACGCAACAAACCTATATTGACTCGGATAGTCAAGACCTTCCGATCAAATCCGTAAGCTCAAGAAAGTCAGAGAAG
TCTTACAGAGGCGTAAGACGACGGCCATGGGGGAAATTCGCGGCGGAGATAAGAGATTCGACTAGAAACGGTATTAGGGT
TTGGCTCGGGACGTTCGAAAGCGCGGAAGAGGCGGCTTTAGCCTACGATCAAGCTGCTTTCTCGATGAGAGGGTCCTCGG
CGATTCTCAATTTTTCGGCGGAGAGAGTTCAAGAGTCGCTTTCGGAGATTAAATATACCTACGAGGATGGTTGTTCTCCG
GTTGTGGCGTTGAAGAGGAAACACTCGATGAGACGGAGAATGACCAATAAGAAGACGAAAGATAGTGACTTTGATCACCG
CTCCGTGAAGTTAGATAATGTAGTTGTCTTTGAGGATTTGGGAGAACAGTACCTTGAGGAGCTTTTGGGGTCTTCTGAAA
ATAGTGGGACTTGGTGA