Details for Arabidopsis Locus AT3G23220

Position : Chr3 ( 5`- 8287950 .. 8288388 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23220

Protein [Map View]
MERIESYNTNEMKYRGVRKRPWGKYAAEIRDSARHGARVWLGTFNTAEDAARAYDRAAFGMRGQRAILNFPHEYQMMKDG
PNGSHENAVASSSSGYRGGGGGDDGREVIEFEYLDDSLLEELLDYGERSNQDNCNDANR*

DNA
ATGGAACGTATAGAGTCTTATAACACGAATGAGATGAAATACAGAGGCGTACGAAAGCGTCCATGGGGAAAATATGCGGC
GGAGATTCGCGACTCAGCTAGACACGGTGCTCGTGTTTGGCTTGGGACGTTTAACACAGCGGAAGACGCGGCTCGGGCTT
ATGATAGAGCAGCTTTCGGCATGAGAGGCCAAAGGGCCATTCTCAATTTTCCTCACGAGTATCAAATGATGAAGGACGGT
CCAAATGGCAGCCACGAGAATGCAGTGGCTTCCTCGTCGTCGGGATATAGAGGAGGAGGTGGTGGTGATGATGGGAGGGA
AGTTATTGAGTTCGAGTATTTGGATGATAGTTTATTGGAGGAGCTTTTAGATTATGGTGAGAGATCTAACCAAGACAATT
GTAACGACGCAAACCGCTAG