Details for Arabidopsis Locus AT3G23210

Position : Chr3 ( 5`- 8283090 .. 8285081 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23210

Protein [Map View]
MYPSIEDDDDLLAALCFDQSNGVEDPYGYMQTNEDNIFQDFGSCGVNLMQPQQEQFDSFNGNLEQVCSSFRGGNNGVVYS
SSIGSAQLDLAASFSGVLQQETHQVCGFRGQNDDSAVPHLQQQQGQVFSGVVEINSSSSVGAVKEEFEEECSGKRRRTGS
CSKPGTKACREKLRREKLNDKFMDLSSVLEPGRTPKTDKSAILDDAIRVVNQLRGEAHELQETNQKLLEEIKSLKADKNE
LREEKLVLKAEKEKMEQQLKSMVVPSPGFMPSQHPAAFHSHKMAVAYPYGYYPPNMPMWSPLPPADRDTSRDLKNLPPVA
*

DNA
ATGTATCCATCAATCGAAGACGATGATGATCTTCTCGCTGCTCTTTGTTTTGATCAAAGCAATGGAGTAGAAGATCCTTA
TGGATATATGCAAACAAATGAAGATAACATATTTCAGGATTTTGGGTCTTGTGGTGTGAATCTGATGCAGCCACAACAAG
AACAATTTGATTCTTTTAATGGAAATCTTGAGCAAGTTTGTAGTAGCTTTAGAGGAGGAAACAATGGAGTTGTTTATAGT
AGTAGCATTGGATCAGCACAATTGGATTTGGCTGCATCGTTTAGTGGAGTTTTGCAGCAAGAGACACATCAAGTCTGTGG
CTTTAGAGGACAAAACGACGATTCTGCAGTGCCTCATTTGCAGCAGCAACAAGGACAGGTGTTTAGTGGTGTAGTGGAAA
TCAATTCTTCGTCATCTGTTGGAGCTGTTAAGGAAGAGTTTGAGGAAGAATGTTCGGGGAAGAGGAGACGAACTGGATCA
TGTAGCAAGCCAGGAACCAAAGCCTGTCGCGAGAAACTAAGAAGGGAAAAGCTAAATGACAAGTTCATGGACTTGAGCTC
TGTTTTAGAGCCTGGCAGGACTCCAAAGACGGATAAATCAGCTATACTCGACGATGCAATCCGGGTTGTGAATCAGCTTA
GAGGTGAAGCTCATGAGCTTCAAGAAACCAACCAAAAGCTTCTAGAAGAGATCAAGAGTCTAAAGGCGGATAAAAACGAG
CTACGAGAGGAAAAGCTGGTGTTGAAGGCGGAGAAGGAGAAGATGGAGCAACAGTTAAAATCTATGGTGGTTCCATCACC
AGGTTTCATGCCCTCCCAGCATCCAGCAGCTTTCCATTCCCATAAGATGGCGGTGGCTTACCCTTACGGCTACTATCCTC
CAAACATGCCAATGTGGTCACCCTTACCTCCTGCTGACCGTGATACGTCTCGTGATCTCAAAAATCTTCCTCCTGTTGCT
TAA