Details for Arabidopsis Locus AT3G23180

Position : Chr3 ( 5`- 8277037 .. 8278396 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23180

Protein [Map View]
MDVVQRKVKKIGRKVASFPHVETIGRALFASSFFLSSWHDYMELKANWNGTEDYWSPKFGYSGDQIKHLMTVSIIVRTLG
GLIFIYGSFFGAFLLLMYQGIATMVHHDFYNHRLDTEEFGLLYLKLKRILNETVSYNTAYNLYKSDFDEQQIEQVKSKFR
ELADHAMTNPALFGHNEFLRRLLSFVKGLAVVGALLFFVDMKYRLNKAKKQSKVKND*

DNA
ATGGATGTTGTGCAAAGAAAAGTGAAAAAAATTGGAAGAAAAGTTGCTTCTTTCCCTCATGTTGAAACTATTGGAAGAGC
TCTCTTTGCCTCCTCCTTCTTCCTCTCTTCTTGGCATGATTACATGGAGCTCAAAGCCAACTGGAATGGAACAGAGGATT
ATTGGAGCCCAAAGTTTGGCTATTCAGGAGACCAGATTAAGCATCTTATGACAGTTAGTATCATTGTGAGAACTCTTGGA
GGACTTATCTTCATCTATGGCAGCTTCTTCGGAGCCTTTCTCTTGCTTATGTACCAAGGCATTGCTACAATGGTTCATCA
TGATTTCTACAATCATCGTTTAGATACTGAAGAATTTGGACTGCTCTATCTCAAACTCAAAAGGATTCTGAACGAAACAG
TGTCGTACAATACTGCATACAATCTCTACAAATCAGACTTTGACGAGCAGCAGATAGAGCAAGTGAAATCAAAATTCCGT
GAGCTTGCGGATCACGCGATGACAAACCCTGCATTGTTCGGACATAATGAGTTTCTTCGTCGGCTCTTAAGCTTCGTCAA
GGGATTGGCCGTAGTAGGAGCATTGCTGTTTTTCGTGGATATGAAGTATCGTCTCAACAAAGCCAAGAAGCAATCCAAAG
TTAAAAATGATTGA