Details for Arabidopsis Locus AT3G23175

Position : Chr3 ( 5`- 8274000 .. 8275470 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23175

Protein [Map View]
MKMSISKVKSMFCTTLTKSMPAIAFFGRMAFSFVFFITAIQDYADHYGGGAGGPLEKTMGPAVNMLSKYGSKALTFYFGM
QVVAFDVRLIEFALISAKATAALWFIFGQSIPAYFLLATQIFSTVIPFPTNLNDFTQNLTLIGALLYYIGLKHTVDNLDD
EEKNKQTEG*

DNA
ATGAAGATGTCAATTAGCAAGGTCAAGAGCATGTTCTGCACAACCTTAACAAAGTCAATGCCAGCCATTGCCTTCTTTGG
GAGAATGGCATTTTCCTTTGTCTTTTTCATTACTGCAATCCAAGATTATGCTGATCATTATGGCGGTGGAGCTGGCGGGC
CACTCGAGAAGACGATGGGACCAGCCGTGAACATGTTGAGCAAATATGGTTCTAAGGCTCTCACATTTTACTTTGGAATG
CAAGTGGTCGCATTCGATGTTCGACTTATTGAGTTCGCACTCATAAGTGCAAAGGCAACCGCAGCTTTATGGTTCATCTT
TGGACAATCCATCCCAGCTTACTTCTTGCTCGCAACGCAAATATTCTCAACTGTCATTCCTTTCCCTACCAACTTGAATG
ACTTCACTCAGAACTTGACGTTAATCGGGGCGTTGCTATATTACATTGGATTGAAGCATACTGTCGACAACCTCGATGAT
GAAGAGAAGAACAAGCAGACCGAAGGATGA