Details for Arabidopsis Locus AT3G23165

Position : Chr3 ( 5`- 8264650 .. 8265060 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23165

Protein [Map View]
MKNSSIMFVLIVVFLISSSENQKMVGEAKQCKTGWACFGEDACKEKCMAKYKGVGTVTYFPFPPETIIIYCECLYDC*

DNA
ATGAAGAACTCTTCTATCATGTTCGTACTAATTGTCGTTTTTCTTATTTCTTCATCAGAGAACCAAAAAATGGTAGGAGA
AGCAAAACAATGTAAAACTGGATGGGCTTGTTTTGGAGAAGATGCATGCAAAGAAAAATGCATGGCTAAATACAAAGGTG
TTGGAACTGTTACTTATTTTCCATTCCCTCCGGAAACTATTATTATATATTGCGAATGCTTGTATGATTGCTAA